KEGG   Porphyrobacter sp. HT-58-2: CHX26_01305Help
Entry
CHX26_01305       CDS       T05364                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
phz  Porphyrobacter sp. HT-58-2
Pathway
phz00380  Tryptophan metabolism
phz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CHX26_01305
Enzymes [BR:phz01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     CHX26_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: AUX68337
UniProt: A0A2L0GH23
Position
complement(272092..272883)
Genome map
AA seq 263 aa AA seqDB search
MSADVTYASYLDLDRILAAQHPASDAHDELLFIIVHQASELWLKLCLHELTAARARIEAN
DLRPAFKMLARVARAQQQLIQSWDVLSTMTPHDYSAIRPHLGASSGFQSAQYRMMEFMLG
GRDGKHVRLHRSNADWADRLETERGRASLYDAAIHLLARRGFAIDTAVLERDPAALWVHN
ASVEAAWAAIYRDPQPYWDLYELAEKLVDLEYHFQRWRFGHLKTVERIIGFKRGTGGTPG
VPYLEGVLKQAFFPELLSVRTAI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagacgtcacctacgcgagctatctcgatctcgaccgcatccttgccgcgcag
cacccggcctcggacgcgcatgacgagctgctgttcatcatcgtgcatcaggcgagcgag
ctgtggctgaagctgtgcctgcacgaactgaccgccgcgcgcgcccgcatcgaggcaaac
gacctgcgtcccgccttcaagatgctcgcgcgggtggcacgggcgcagcagcaactgatc
cagagctgggacgtgctcagcacgatgaccccgcatgattactccgccatccgcccccat
ctgggcgcgtcgagcgggttccagtcggcgcagtaccgcatgatggaattcatgctcggc
gggcgcgatggcaagcatgtgcgcctgcaccgttccaatgccgactgggccgaccggctg
gagacagagcgcgggcgggcgagcctttatgatgcagcaatccacctgctggcgcggcgt
ggtttcgcgatcgacacggcagtgctggaacgcgatcccgccgcgctctgggttcacaac
gcaagtgtcgaggcggcctgggcggcgatctatcgcgatccccaaccctattgggatctg
tatgaactggcggagaaactggtcgatctggaataccacttccagcgctggcgcttcggc
catctcaagaccgttgagcggatcatcggcttcaagcgcggcaccggcggcacgccgggt
gtgccctatctcgaaggggtgctgaagcaggcgtttttccccgaattgctgagcgtcagg
accgcgatatga

DBGET integrated database retrieval system