KEGG   Porphyrobacter sp. HT-58-2: CHX26_04385Help
Entry
CHX26_04385       CDS       T05364                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
phz  Porphyrobacter sp. HT-58-2
Pathway
phz00071  Fatty acid degradation
phz00072  Synthesis and degradation of ketone bodies
phz00280  Valine, leucine and isoleucine degradation
phz00310  Lysine degradation
phz00362  Benzoate degradation
phz00380  Tryptophan metabolism
phz00620  Pyruvate metabolism
phz00630  Glyoxylate and dicarboxylate metabolism
phz00640  Propanoate metabolism
phz00650  Butanoate metabolism
phz00900  Terpenoid backbone biosynthesis
phz01100  Metabolic pathways
phz01110  Biosynthesis of secondary metabolites
phz01120  Microbial metabolism in diverse environments
phz01130  Biosynthesis of antibiotics
phz01200  Carbon metabolism
phz01212  Fatty acid metabolism
phz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHX26_04385
   00630 Glyoxylate and dicarboxylate metabolism
    CHX26_04385
   00640 Propanoate metabolism
    CHX26_04385
   00650 Butanoate metabolism
    CHX26_04385
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHX26_04385
   00072 Synthesis and degradation of ketone bodies
    CHX26_04385
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CHX26_04385
   00310 Lysine degradation
    CHX26_04385
   00380 Tryptophan metabolism
    CHX26_04385
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHX26_04385
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CHX26_04385
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CHX26_04385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phz04147]
    CHX26_04385
Enzymes [BR:phz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CHX26_04385
Exosome [BR:phz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHX26_04385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TLP1_add_C
Motif
Other DBs
NCBI-ProteinID: AUX68847
UniProt: A0A2L0GIH9
Position
900349..901884
Genome map
AA seq 511 aa AA seqDB search
MSTEVADNTPVVIGVGQYSERVGEPGYEALSYVDLAGRALAGAIADSGASGDVAGAIDTL
AAIRAFEMSRPDRKPPFGAANNVPRAIAKRVGANPARAILTTTGGQTNQQLVGEFAQAIA
AGESQCAVIVGSEAISTVLALSAKGEIPDWSEDVPGDFEDQGFGVEELMEPALFMHGASG
AIPLYALAENARRHRLGMGLEEYRLAIGKLFAPFTKVAAANPHSAAPVERSAEELATVTD
RNRIVAEPYPRMTVARDQVNQAAAVIVASAGLARALGVPEDRWVHIHAVTAATELKLSQR
PDLAGNPASLASVDAALARAGKGIGDIRYIDFYSCFAIPVFNQCDHFGLAIDDPRGLTLT
GGLPFFGGAGNNYSAHAIAEAVQRVREDRGSFALVGANGGWMSKYATGIYSTEPADWSAN
DRFTVLPKATDKVPVAKDPVEAATVETYTINRGPKGAEAIFIGRSDAGERVVGNADLSDA
ATAEAFESGEPFGNRLTLTQDERGRTVGRLA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgactgaggtcgctgacaacaccccggtcgtgatcggggtgggccagtattcggag
agggtgggcgagcccggctacgaagccctctcctatgtggatctggcgggccgcgcgctg
gccggagctatcgcggacagcggggcgagcggtgatgtggcgggtgccatcgacaccctc
gccgcgatccgcgctttcgaaatgtcgcggcccgacaggaagccgcccttcggcgcggcc
aacaacgtgccgcgcgcgattgccaagcgcgtcggcgcgaacccggcgcgggcgatcctg
acgacaacgggcgggcagaccaaccagcagttggtgggcgaatttgcgcaggcgatcgct
gcgggtgagagccagtgcgcggtgatcgtcggctccgaggcgatctcgaccgtgctggcg
ctgtcggccaagggcgagatccctgattggtcggaggatgtgccgggcgatttcgaggat
cagggcttcggcgtcgaggaactgatggagcccgcgctgttcatgcacggcgcgagcggg
gcgatcccgctctatgcgctggctgagaacgcgcggcggcatcggctgggcatggggctg
gaggaatatcgcctcgcaatcggcaagctgttcgcgcctttcaccaaggtggcggcagcg
aacccgcattcggcggctccggtggagcgcagcgccgaggaactcgccaccgtcactgac
cgcaaccggattgtggccgagccctatccgcgcatgaccgtcgcccgcgatcaggtgaat
caggcggcggcagtgatcgtggcttcggcggggctggcgcgcgctttgggtgttcctgaa
gacaggtgggtgcacatccacgccgtcaccgccgcgactgagctgaagctgtcgcagcgg
cccgatctggcgggcaaccccgcctcgctcgccagtgtcgatgcggcgctggcgcgggcg
gggaaggggatcggcgacatccgctacatcgacttctattcgtgcttcgcgattccggtg
ttcaaccagtgcgaccacttcggcctcgccatcgacgacccgagggggctgacgctgacc
ggcggcttgccgttcttcggcggggcggggaacaattactcggcccacgccatcgccgag
gcggtgcagcgggtgcgggaggatcgtggcagcttcgccctcgtgggcgcgaatggcggg
tggatgagcaaatacgcgaccggcatctattcgaccgaaccggcggactggtccgcgaac
gaccgcttcaccgtgctccccaaggcgaccgacaaggtgcctgtggcgaaagatccggtc
gaagccgctacggtcgagacctacaccatcaaccgcggccccaagggtgccgaggcgatc
ttcatcggccggtcggatgcgggcgagcgggtggtgggcaatgccgacctttcggacgcg
gcgactgctgaggccttcgaaagcggcgagcctttcggcaatcgcctgactctgacgcag
gacgagcgcgggcggacggtggggcggctggcctag

DBGET integrated database retrieval system