KEGG   Porphyrobacter sp. HT-58-2: CHX26_11240Help
Entry
CHX26_11240       CDS       T05364                                 

Definition
(GenBank) nitrilase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
phz  Porphyrobacter sp. HT-58-2
Brite
KEGG Orthology (KO) [BR:phz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHX26_11240
Enzymes [BR:phz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CHX26_11240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AUX70959
UniProt: A0A2L0GQR5
Position
complement(2386816..2387613)
Genome map
AA seq 265 aa AA seqDB search
MTSGIDPEANLAVIEDAAKQCAKRGALVLFTPEMALLLDRDRSRARQWIESPAPAAMIEQ
ISVIAAKQHLDIVIGSMPVATGSGMWANRAHYFHPDLGEPVTYDKIHMFDVDLASGESWR
ESNAYEPGREVMTVERTPLGRLGLTICYDLRFPALFEELGNRRCDCIAVPAAFTKPTGAA
HWHVMLRARAIEAQAFVIAAAQVGRHADGRETYGHSLVVDPWGEVLLDMGGEAPGLGFCE
IDLRRINEVRAQVPALANRRAIPKS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgggcattgatcccgaggccaatcttgcggtcatcgaagatgcggcgaagcaa
tgcgccaagcgcggcgcactggtgctgtttaccccggaaatggctttgctgctcgaccgc
gaccgctcccgcgcgcgccagtggattgaaagcccggcgcccgctgcaatgatcgagcag
atatcggtgatcgcggccaagcagcatctcgatatcgtgatcggctcgatgcccgtggcg
acgggaagcggcatgtgggccaaccgcgcgcattactttcaccccgatcttggcgagcct
gtcacctacgacaagatccacatgttcgatgtcgatctcgccagcggagaaagctggcgg
gagagcaacgcctatgagccgggcagagaggtcatgacggtggagcgcaccccgctcggg
cggcttggcctcacgatctgctatgacttgcggttccccgcgctgttcgaggaattgggc
aaccgccgctgtgattgcatcgcggtccccgcagccttcaccaagcccaccggcgctgcg
cattggcacgtgatgctccgcgcccgcgcgatcgaggcgcaggccttcgttatcgccgct
gcgcaagtgggtcgccacgcggacgggcgcgagacctacggtcactcccttgtggtcgat
ccgtggggtgaggtgttgctcgacatggggggcgaggcgccggggctgggtttctgcgaa
atcgaccttcgccgtatcaatgaagtgcgcgcgcaggtgccggcccttgccaaccgccgc
gccattcccaaatcctga

DBGET integrated database retrieval system