KEGG   Porphyrobacter sp. HT-58-2: CHX26_12865Help
Entry
CHX26_12865       CDS       T05364                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
phz  Porphyrobacter sp. HT-58-2
Pathway
phz00564  Glycerophospholipid metabolism
phz01100  Metabolic pathways
phz01110  Biosynthesis of secondary metabolites
Module
phz_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:phz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CHX26_12865 (psd)
Enzymes [BR:phz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CHX26_12865 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AUX70267
UniProt: A0A2L0GMJ5
Position
2723680..2724531
Genome map
AA seq 283 aa AA seqDB search
MSSAFIALQHLLPQHALSRLAGRLADSRRPWLRDRLIRRFAAAYAVDLSEAERQIGQFAS
FNDFFTRELKPGARPLADAAQFILSPADGAISQCGTITAGRILQAKGRDYSVTEILGGDE
AEAARFEGGTWMTIYLSPRDYHRVHMPAAGTLAATTYLPGKLFSVNTATADGVDRLFARN
ERLACLFDGPDGRFASIMVGAMIVAGIDTVWPSKHRTHGAALLHEDFGGTGPVLAAGAEM
GRFYLGSTVVLLFEPGRVQWLDGLEAGTALRMGQAIGRRLGAG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagctttcatcgcgctccagcaccttttgccccagcacgctctgtcgcggctt
gccggacggctcgccgacagccgccgcccgtggctgcgcgatcgcctgatccgccgcttt
gccgccgcctatgcggtcgacctttccgaagccgagcgccagatcggccagtttgccagc
ttcaacgacttcttcacccgcgagctgaagccgggcgcccgcccgctggcggatgcggcg
cagttcatcctctcgcctgccgacggcgcgatcagccagtgcggcacgattaccgccggg
cgcatcctgcaagccaaggggcgcgattacagcgtgaccgaaatccttggcggcgatgag
gcagaggcagcgcggttcgaaggcgggacgtggatgacgatctacctctccccgcgcgat
taccaccgcgtgcacatgcccgctgccggaacgctggcagccacgacctaccttccgggc
aagctgttttcggtcaacaccgccaccgctgacggggtcgacaggctgttcgcccgcaac
gaacgcctcgcttgcctgttcgacgggccggatgggcgctttgcgagcatcatggtgggc
gcgatgatcgtcgccgggattgataccgtctggccgagcaagcaccggacccacggcgct
gcattgctgcatgaggatttcggcggcaccggcccggtgctcgcggcaggggcggaaatg
ggccgcttctaccttggctccaccgtagtcttgctgttcgagcccggacgggtgcaatgg
ctcgacgggctggaggcgggaactgccttgcgcatggggcaggcaatcggacgacggctt
ggcgccgggtga

DBGET integrated database retrieval system