KEGG   Pseudoalteromonas issachenkonii: PI2015_1451Help
Entry
PI2015_1451       CDS       T04164                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
pia00071  Fatty acid degradation
pia00072  Synthesis and degradation of ketone bodies
pia00280  Valine, leucine and isoleucine degradation
pia00310  Lysine degradation
pia00362  Benzoate degradation
pia00380  Tryptophan metabolism
pia00620  Pyruvate metabolism
pia00630  Glyoxylate and dicarboxylate metabolism
pia00640  Propanoate metabolism
pia00650  Butanoate metabolism
pia00900  Terpenoid backbone biosynthesis
pia01100  Metabolic pathways
pia01110  Biosynthesis of secondary metabolites
pia01120  Microbial metabolism in diverse environments
pia01130  Biosynthesis of antibiotics
pia01200  Carbon metabolism
pia01212  Fatty acid metabolism
pia02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pia00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PI2015_1451
   00630 Glyoxylate and dicarboxylate metabolism
    PI2015_1451
   00640 Propanoate metabolism
    PI2015_1451
   00650 Butanoate metabolism
    PI2015_1451
  Lipid metabolism
   00071 Fatty acid degradation
    PI2015_1451
   00072 Synthesis and degradation of ketone bodies
    PI2015_1451
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PI2015_1451
   00310 Lysine degradation
    PI2015_1451
   00380 Tryptophan metabolism
    PI2015_1451
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PI2015_1451
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PI2015_1451
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PI2015_1451
Enzymes [BR:pia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PI2015_1451
Exosome [BR:pia04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PI2015_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALQ54753
UniProt: A0A290SDD5
Position
I:1632860..1634041
Genome map
AA seq 393 aa AA seqDB search
MSFESVVIVAAKRTPMGGFMGALSDAQSTELGATAIAGALAQTGLSNDAIDEVIMGCVLP
AGLGQAPARQAMLKAGLALSTGATTINKVCGSGLKAAMLANDLIKAGSIESAIAGGMESM
TNAPYFIPKARGGMRMGHGEIKDHMMSDGLEDAYDNKAMGCFAQDTADEYGIGREQMDAF
ALGSLSKANAAIENGSFDNEIAPHTIKTRKGDVTVSIDEQPGNARPEKIPSLRAAFKKDG
TITAANSSSISDGGAALILMSESKAKTEGLTPLCKIVAHSTHSQKPSEFTVAPVGAMNSV
LEKAGWTTADVDLWEINEAFAMVTMLAINELKLDENKVNVNGGACALGHPIGASGARILV
TLIHALKNRGLKKGVASLCIGGGEAVAMAVEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaaagcgttgtaattgtagcagcaaaacgcaccccaatgggtggatttatg
ggcgcactaagtgatgcgcagtctaccgaactaggtgctacagctattgcaggtgcactt
gctcaaacgggtttaagcaatgatgcaattgatgaagtgattatgggctgtgtattgcct
gcaggcttaggccaagcgcctgcacgtcaagctatgcttaaagcggggcttgcacttagc
accggtgctaccactattaataaagtatgtggctcgggtttaaaagcagcgatgttagcg
aatgatttaattaaggcgggttctattgaatcagcaatcgctggtggtatggaaagcatg
accaatgcgccttactttattcctaaagcacgtggcggcatgcgtatgggccatggtgaa
ataaaagatcatatgatgagcgatggccttgaggatgcttacgacaataaagcaatgggt
tgttttgctcaagacacggctgatgaatacggtattggccgtgagcaaatggacgcgttt
gcactgggttcgttaagtaaagcaaacgcagccatagaaaatggtagctttgacaacgaa
atcgcccctcatactattaaaacccgtaaaggcgatgtaacagtttcaattgatgaacaa
cctggtaatgcccgccctgaaaaaatcccaagtttacgtgcagcatttaaaaaagacggc
accattactgcggcaaactcatcatcaatttcagatggtggcgcagcactgattttaatg
agcgaatcaaaagcaaaaacagagggtttaacgccactgtgcaaaattgttgctcacagc
acgcattctcaaaaacccagtgaatttaccgtagcgcctgttggtgcaatgaacagtgtg
cttgaaaaagcagggtggacaaccgcagatgttgacctatgggaaattaacgaagcgttt
gccatggttaccatgctagctattaacgagttaaagcttgatgagaacaaagttaatgtt
aacggtggcgcctgtgcattgggtcatcctattggtgccagcggtgcgcgtattttagta
acactgatccatgcacttaaaaaccggggtcttaaaaagggcgtagcctctttatgtatt
ggtggcggtgaagccgttgccatggccgtagaagcactttaa

DBGET integrated database retrieval system