KEGG   Pseudoalteromonas issachenkonii: PI2015_1564Help
Entry
PI2015_1564       CDS       T04164                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
pia00020  Citrate cycle (TCA cycle)
pia00310  Lysine degradation
pia00380  Tryptophan metabolism
pia01100  Metabolic pathways
pia01110  Biosynthesis of secondary metabolites
pia01120  Microbial metabolism in diverse environments
pia01130  Biosynthesis of antibiotics
pia01200  Carbon metabolism
Module
pia_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pia_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PI2015_1564
  09105 Amino acid metabolism
   00310 Lysine degradation
    PI2015_1564
   00380 Tryptophan metabolism
    PI2015_1564
Enzymes [BR:pia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PI2015_1564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N Biotin_lipoyl_2 GCV_H HTH_17 YqfD
Motif
Other DBs
NCBI-ProteinID: ALQ54862
UniProt: A0A290SDJ9
Position
I:complement(1744020..1745537)
Genome map
AA seq 505 aa AA seqDB search
MSTEIKVPVLPESVADASVATWHVSVGDKVSRDQNLVDIETDKVVLEVVAQNDGVITEIL
QEEGATVLGDQVIGLIGDAQEASPSKEPKEDSSASEKSEDAPAAQSAPASEGKEVDIKVP
VLPESVADATIATWHVQPGVAVTRDQNLVDIETDKVVLEVVAQEDGVMGEIIHDEGDTVL
GEQVIGKVKAGAAPDKSDAKADAPAAKEESSSEGSDVLTPSVRRLIAEKGLDASKIKGSG
KNGRVTKEDVDQFLKSPAPAAKAEAAPAAPMGDRTQKRVPMTRLRKTIANRLLEAKNSTA
MLTTFNEVNMKPIMDLRKQYQEVFEKRHGIRLGFMSFYVKAVTEALKRFPDVNASIDGDD
IVYHNYFDISIAVSTPRGLVTPVLKDCDKLSVAEIEKGIRELALKGRDGKLTLDDMTGGN
FTITNGGVFGSLLSTPIINLPQSSILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRQID
GKESVGFLVTIKELLEDPTRLLLDV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaaattaaagttcctgttcttcctgagtcggttgcagatgcttccgttgct
acatggcatgtaagtgttggcgacaaagtaagccgtgaccaaaacttagtagatattgaa
acagacaaagtggttttagaagtggttgcacaaaatgacggtgtgatcactgaaatttta
caagaagaaggtgctacggtacttggtgaccaagtgatcggtttaattggtgatgcgcaa
gaagcatcaccaagtaaagagccaaaagaagatagctcagcatcagaaaaatcagaagac
gcgccggcggcgcaatcagcaccagcatcagaaggtaaagaagtggatattaaagtacct
gtacttccagaatcagttgcagatgcaacaattgctacttggcatgttcaaccaggtgtc
gcggtaacacgcgaccaaaacttggttgatattgaaacagataaagttgtacttgaagtg
gttgcccaagaagacggcgttatgggtgaaatcattcatgacgaaggcgatactgttctt
ggtgagcaagtcattggtaaagtaaaagcaggcgctgcacccgataaatctgacgctaaa
gcggatgcaccagcagccaaagaagaaagctcaagcgagggttcagatgtgttaacgcca
tcagttcgtcgtttaattgctgagaaaggccttgatgcatcaaaaatcaaaggttcaggc
aaaaatggtcgtgtgactaaagaagatgttgatcaattcttaaaatcacctgctccagcg
gcaaaagctgaagcagcgccagcagcacctatgggtgaccgtacacaaaaacgtgtgcct
atgacacgtttacgtaaaacaattgcgaatcgtcttcttgaagcgaaaaactctactgca
atgttaactacatttaacgaagttaacatgaagccaatcatggatcttcgtaagcagtac
caagaagtatttgaaaagcgccacggtatccgtttaggtttcatgtctttctacgtgaaa
gcagtgactgaagcgttaaagcgtttcccagatgtaaatgcatcaattgatggcgatgat
attgtttaccacaactatttcgacatcagcattgctgtttctacacctcgtggcttagta
acacctgtactcaaagattgtgacaagctatctgttgcagaaatcgaaaaggggattcgt
gagctagcgcttaaaggtcgtgatggtaagctaacgcttgacgatatgaccggcggtaac
ttcactatcaccaacggtggtgtattcggttcgttactatctactccaattattaactta
ccgcagtcttcaattttgggtatgcacaaaatccaagatcgtccaatggctgtaaacggt
aaagttgaaatcttacctatgatgtacttagcgttatcttacgatcaccgccaaatcgat
ggtaaagaatcagttggtttcttagtaacaattaaagagttacttgaagatccaacacgt
ttactgctggatgtttaa

DBGET integrated database retrieval system