KEGG   Pseudoalteromonas issachenkonii: PI2015_1621Help
Entry
PI2015_1621       CDS       T04164                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
pia00450  Selenocompound metabolism
pia00970  Aminoacyl-tRNA biosynthesis
pia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pia00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PI2015_1621
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PI2015_1621
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pia01007]
    PI2015_1621
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pia03016]
    PI2015_1621
Enzymes [BR:pia01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PI2015_1621
Amino acid related enzymes [BR:pia01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PI2015_1621
Transfer RNA biogenesis [BR:pia03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PI2015_1621
 Prokaryotic type
   Other AARSs
    PI2015_1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ALQ54915
Position
I:1808163..1810187
Genome map
AA seq 674 aa AA seqDB search
MAQRKILITSALPYANGPTHLGHLLEYIQTDIWSRFQKLQGHEAYYVCADDAHGTPIMLN
AQKQGITPEEMVKNVSIERQRDFADFNIKFDNYHSTHSQENKEFSELIYNRLNDAGHIKK
HTISQLFDPEKGIFLPDRFVTGTCPTCKSEDQNGDSCDACGATYSPTELINPRSVMSGAE
PILKDSEHYFFDLPAFEDMLKEWLHSGTIQQEMANKLDEWFADGLQQWDISRDAPYFGFE
IPNAPGKYFYVWLDAPIGYMASFKNLCDKQGIDFDAFWQEGSDAELYHFIGKDIIYFHSL
FWPAMLEGAQFRKPTNVFAHGFVTVNGAKMSKSKGTFIKARTYLDNLDPEFLRYYYAAKL
NSGITDLDLNLEDFAQRVNSDLVGKVVNIASRCAGFITKKFDGKLSNTVMQPQLLAEFQN
ASATITEYYENREYSRAIREIMALADKANQFIDNAAPWVLIKDESKQEEAHQVCSLGLNL
FRVLITYLKPVLPGMASNVEAFLNDELSWQGAQTALVNHPINKFKPLMQRVEMDKVNKMV
EESKESLVAEKDKIDPNSPLAKEPISEEIEFDDFAKVDLRVAKIAKAEHVEGADKLLKLT
LDLGGETRQVFAGIKSAYAPEDIEGKLTVMVANLKPRKMRFGMSEGMVLAAGPGGKEIYI
LNPDDGSEPGMRVM
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcgaaagatcctgattactagcgcattaccttatgccaatggccctacccat
ttagggcatttattagagtatattcaaactgatatttggtcgcgttttcaaaaactacaa
ggccacgaagcgtactatgtgtgcgccgatgatgctcatggcacacctattatgcttaat
gcgcaaaagcaagggatcacgcctgaggaaatggtaaaaaacgttagcattgagcgccaa
cgcgactttgctgattttaatatcaaatttgataattaccacagtacccatagccaagag
aataaagaatttagtgagcttatttataatcgccttaacgatgcaggtcatattaaaaag
cacactatttcacagttattcgatccagaaaaaggcatttttctgccagatcgctttgtt
actggcacgtgtcctacatgtaaatcagaagatcagaacggggatagctgtgatgcctgt
ggcgcaacctatagcccaaccgagctaatcaacccacgctctgttatgtcgggtgctgag
cctatcttaaaagattctgagcattacttttttgatttacccgcctttgaagacatgctt
aaagagtggctacattcaggcacaattcaacaagaaatggccaacaagttagatgagtgg
tttgccgatggtctccagcaatgggacattagccgtgatgcaccttattttggttttgaa
attccaaacgcaccaggtaaatacttttacgtatggctagatgcgcctattggttatatg
gcgagctttaaaaacttatgtgataaacagggcatcgactttgatgcattttggcaagaa
ggttcagatgctgagctttatcactttattggtaaagacatcatctatttccacagccta
ttttggcctgctatgttagaaggcgctcaatttagaaagccaactaatgtattcgcccat
ggttttgttacggtcaatggcgcaaaaatgtctaaatcaaaaggcacgtttattaaagcg
cgtacttatttagataacctagacccagaatttttacgttactactacgcagctaaactt
aatagtggcattactgatttagatttaaaccttgaagattttgcacaacgtgtaaactca
gacttagtgggtaaagtagtgaatattgccagtcgttgtgctggttttattactaaaaag
ttcgacggtaagctgagcaatacagttatgcaacctcaattgcttgcagaattccagaac
gcatcagcgacaatcaccgaatattacgagaaccgtgaatacagccgcgcaattcgtgaa
atcatggcacttgctgataaagcaaaccagttcattgataatgccgcaccttgggtgctt
attaaagatgagtcaaagcaagaagaagcgcatcaggtttgctcactaggacttaaccta
tttcgcgtgttgatcacttacttaaaaccagtgctacctggcatggcaagtaatgttgaa
gcctttttaaatgatgaattatcttggcagggtgcgcaaacagcgttagtaaaccaccct
atcaataaatttaagccgttaatgcaacgtgtagaaatggataaagtgaataaaatggtt
gaagaatcaaaagaaagcttagttgctgaaaaagacaaaatcgatcctaatagcccactt
gcaaaagagcctattagcgaagagattgagtttgatgactttgcaaaggtagacctgcgt
gttgctaaaattgccaaagcagagcacgtagaaggcgctgacaagctgcttaaattaacc
cttgatttaggcggtgaaactcgccaagtgtttgctggaattaaatcggcttacgcacca
gaagacattgaaggtaaattaacggtaatggttgctaacctcaaaccacgtaaaatgcgt
tttggaatgtctgaaggcatggtacttgcggcaggccctggtggtaaagaaatttacatt
cttaacccagacgacggctctgagccgggtatgcgcgtaatgtaa

DBGET integrated database retrieval system