KEGG   Pseudoalteromonas issachenkonii: PI2015_2612Help
Entry
PI2015_2612       CDS       T04164                                 

Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
pia  Pseudoalteromonas issachenkonii
Brite
KEGG Orthology (KO) [BR:pia00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PI2015_2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ALQ55879
UniProt: A0A290SGF9
Position
I:2913024..2913413
Genome map
AA seq 129 aa AA seqDB search
MTTSSNIGSPVKVSVETFYVEEQSQPELDKFVFAYSVTIKNHSLCSAKLLSRYWLITDAN
GKEVEVQGEGVVGETPDIAPGESYKYTSGAIIDTPVGTMQGHYTLRNEFGAEFKAPINVF
RLACPNILH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaagcagtaatataggatcacctgtaaaggtatctgttgaaacgttttatgta
gaagagcaatcgcaacctgaactagataagtttgtgttcgcctactccgttactataaaa
aaccacagtttatgcagtgcaaagctacttagccgttattggctaattactgatgccaat
ggcaaagaagtagaagtgcaaggcgaaggtgtggtgggtgaaaccccagatatagcccca
ggtgaaagctacaaatataccagtggtgcaataatagatacaccggtaggcaccatgcag
ggacattacactttacgtaacgagtttggtgctgaatttaaagcacccataaacgtattc
cgcttagcctgccctaatatcctacactga

DBGET integrated database retrieval system