KEGG   Pseudoalteromonas issachenkonii: PI2015_3425Help
Entry
PI2015_3425       CDS       T04164                                 

Definition
(GenBank) Maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
pia00350  Tyrosine metabolism
pia00643  Styrene degradation
pia01100  Metabolic pathways
pia01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pia00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PI2015_3425
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    PI2015_3425
Enzymes [BR:pia01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     PI2015_3425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C GST_N_4
Motif
Other DBs
NCBI-ProteinID: ALQ56664
UniProt: A0A290SQ71
Position
II:complement(463783..464412)
Genome map
AA seq 209 aa AA seqDB search
MKLYTYFRSSAAYRVRIALNLKNIDHQLVPVNLLKSEQQSTDYLQKNPQGLLPALETEDG
VLGQSLAILEYLEEQYPETPLLPGNAWQKAHIRNLSYAIACDIHPIDNLRVLKYLSSELN
VDDEAKNKWYRHWVEVGFEKIERMLDSKNTFCAGESPSLADVCLVPQVFNAIRFKVDMAA
YPKIAAIYQRCNELAAFIDAAPENQPDAN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttatacttattttcgctcatctgcagcgtatcgtgtgcgcatcgcattaaac
ctaaaaaatattgatcaccagttggtgccggtaaacttactaaaatcagagcaacaaagc
acagattacttacagaaaaacccccaaggacttttacctgctttagaaacagaagacggc
gtattaggtcaatctctagcaattttagagtaccttgaagagcaataccctgaaacacca
ttactgcctggtaatgcatggcaaaaagcacatattcgcaatttaagttatgcaattgcc
tgtgatattcacccgattgataatttacgtgtgcttaagtatttaagtagtgaactcaat
gttgatgatgaagcaaaaaataaatggtaccgccactgggttgaagtgggttttgaaaaa
atagaacgcatgctcgatagtaaaaatacattttgcgcaggcgagtcgccaagcttagct
gatgtatgtttagtaccgcaggtatttaatgccattcgttttaaagtagatatggctgcc
taccctaaaatagcagccatatatcagcgttgtaatgagttggcagcctttattgatgca
gcccctgaaaatcaacctgatgcaaactaa

DBGET integrated database retrieval system