KEGG   Pseudoalteromonas issachenkonii: PI2015_3500Help
Entry
PI2015_3500       CDS       T04164                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
pia00330  Arginine and proline metabolism
pia00360  Phenylalanine metabolism
pia00380  Tryptophan metabolism
pia00627  Aminobenzoate degradation
pia00643  Styrene degradation
pia01100  Metabolic pathways
pia01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pia00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PI2015_3500
   00360 Phenylalanine metabolism
    PI2015_3500
   00380 Tryptophan metabolism
    PI2015_3500
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PI2015_3500
   00643 Styrene degradation
    PI2015_3500
Enzymes [BR:pia01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     PI2015_3500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALQ56736
UniProt: A0A290SN73
Position
II:complement(547564..549069)
Genome map
AA seq 501 aa AA seqDB search
MSIKRLLLTLCVCTITNLHAAANNTELKTISDIHSAYKNNSTTAEQLTRTYIDRINALNP
KYNAVISIEPTAIEQAKELDALFKAGKWAGPLHGIAVLLKDNIETTGTLPTTAGSLALKN
NITNKDAFVVKQLRQAGAIILGKANLSEWANFRSSYSSSGWSAIGGQTHNAHDVTRNPCG
SSSGSAVAVALNFAPIALGTETDGSITCPASVNGVYAIKPSMGQVSRAGVVPLSSSQDSV
GPMAHSLKDALAVLSVIQGEDPNDVSTLNVNRKLDSIAPKPSLRIGALPASKFTVETQKL
YAKQLQALKDAGHTVVNVEVKDDLSTLYVDEYAILLYDFKAEINHYLSQTPTQVTVKSLD
DLIAFNTANKQQEMLYFEQDILQQANAVDLSEKQQYQKTKARYRALANRAISNLYRNNKL
DIVIAPTVSPAWKTDLINGDNFKGSSSSLPAIAGTTHITLPVGKVSHLPVGLSVIANQNA
EAAAYAYAAIIDNVLGIKKPE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagtataaaacggctacttttaaccttatgtgtttgtacaataactaacttacacgca
gcggctaacaatacagagcttaaaactattagtgacattcacagcgcctataaaaataat
agcactacagctgaacagcttacccgcacttatatcgacagaataaacgcgctcaatcct
aaatataatgcagtaattagtattgagcccactgcaattgaacaagccaaagaactcgat
gcactgtttaaagccggaaaatgggcaggccctttacatggtattgcggtattactaaaa
gataacattgaaacaacaggtacattacccactacagcgggctcattagcactaaaaaat
aacattaccaataaagatgcctttgtggttaaacaattacgccaagcaggcgctattatt
ttaggcaaagcgaacttaagtgaatgggctaattttcgctcatcgtattcgtcatctggt
tggagtgcaataggtgggcaaacccataacgcccatgatgtaacgcgtaatccgtgtggc
tcaagttcgggctctgctgtcgcggttgctttaaattttgcacctattgcgctgggcact
gaaaccgacggctcaattacctgccctgcatctgttaatggggtgtacgccataaaaccc
agtatgggacaagtttcgcgcgcaggcgtggtgccactttctagtagccaagattcggta
ggcccaatggcacattctttaaaagatgcactcgcagtattgtctgtcattcaaggggaa
gaccctaatgatgtatcaacactcaacgtaaatagaaagcttgatagtatagcgcctaag
ccgtcactgaggataggcgctttacctgccagtaagtttactgtggaaacacaaaaactt
tacgctaaacagctacaagcattaaaagacgcaggtcataccgttgtcaatgttgaagta
aaagatgatttaagcacactttacgttgatgaatacgccatcttgctttacgactttaaa
gccgaaattaatcactatttaagccaaacaccaacgcaagtaacggtaaaaagcttagac
gatttaatcgcattcaataccgcaaataaacagcaagaaatgctctactttgagcaagat
attttacagcaagctaacgcggttgatttgagtgagaaacaacaatatcaaaaaaccaag
gcgcgttatcgcgcactagcaaaccgcgctattagcaatttataccgcaataataagctc
gatattgtgattgcacccaccgtttcgcccgcctggaaaaccgatttaattaacggtgat
aactttaaaggcagtagtagttcattgcctgccattgcaggaacaacccatatcactttg
ccagtaggtaaagtaagccacttaccggttgggctgtcggttattgctaatcaaaatgct
gaagcggctgcttatgcgtacgctgctattatcgataatgtattaggcataaaaaaacct
gagtaa

DBGET integrated database retrieval system