KEGG   Paenibacillus ihbetae: BBD41_02975Help
Entry
BBD41_02975       CDS       T05154                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pib  Paenibacillus ihbetae
Brite
KEGG Orthology (KO) [BR:pib00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pib03009]
    BBD41_02975
Enzymes [BR:pib01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     BBD41_02975
Ribosome biogenesis [BR:pib03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BBD41_02975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: ANY71625
UniProt: A0A1B2DVA1
Position
complement(681991..683055)
Genome map
AA seq 354 aa AA seqDB search
MDEWNVNDDQEQQQDFHSKLVCTANHGFAPYAQEELRRMFGSLKSSMLIPGEVFLVTLAR
SAEEAVRGIRTQPPIFLRHLFPVNVELTASHAEEALNEAERYLLNREEIGKSRVALQIRK
SEHSSWTDSPGALRDLLQSRLSALELEFIVQEPEWIISIFADEETWYLGVSRPEDNLSDW
NGGAIRFQREEGQISRAKFKLLEAEKQFGIPFRSFRRALDIGAAPGGWTSFLLEQGLEVT
AVDPARMHPSLEGNPMLRVIHKNAADVSFKEQEFDLLVCDMSWSPKQMARLVTGLLYSLQ
TGGTAVITVKLLTKKPMALIKEIIAIFEDARMQIQGAKQLFHNRDEITLYMIKY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttggacgaatggaatgtgaatgatgatcaggagcagcagcaggatttccacagcaagctg
gtgtgcacggcgaatcacgggttcgctccctatgcgcaggaggagctgcgccggatgttc
ggcagcctaaaaagctccatgttaatacccggtgaagtgtttctcgttacattggcaaga
tccgcagaagaggcagtgagggggattcgaacacagccccctatatttctgaggcatctg
tttcccgtgaatgtcgaactgactgccagtcatgcggaagaagcgctgaacgaggcggag
cggtatttgctgaatcgggaggagatcggcaagagccgggttgcactccaaatccggaag
agcgaacacagctcttggacggatagtccgggagcattacgcgatttgctgcagagccga
ttgtcggcgctggagctggaatttatcgtgcaggaaccggagtggatcatttcgatcttt
gccgatgaggaaacctggtacctgggcgtttcgagacccgaggacaatttgtccgactgg
aacggcggagccatacgattccaacgcgaggagggtcagatctccagagcgaagttcaag
cttcttgaagccgaaaagcagttcgggattcctttccgcagcttccgtcgagccttggat
atcggtgcggcccccggcgggtggacatcgtttttactggagcagggcttggaggtaacg
gctgtggatccggcgcgcatgcacccgtccttggaggggaacccgatgcttcgggtcatt
cataaaaatgcggcggacgtatcgtttaaggagcaggagttcgatctgctggtctgcgat
atgagctggagtccgaagcaaatggccagattggtgacaggcctgctgtacagtcttcag
acaggcggaacggcggttattaccgtcaagctcctgaccaagaagccaatggcgcttatt
aaggagatcatcgcgatatttgaggatgcccggatgcagattcagggagcgaagcagctg
ttccacaaccgggatgaaattacgctctacatgataaagtattaa

DBGET integrated database retrieval system