KEGG   Paenibacillus ihbetae: BBD41_15670Help
Entry
BBD41_15670       CDS       T05154                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00480  Glutathione metabolism
pib00590  Arachidonic acid metabolism
pib01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pib00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BBD41_15670
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BBD41_15670
Enzymes [BR:pib01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BBD41_15670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin US30
Motif
Other DBs
NCBI-ProteinID: ANY73899
UniProt: A0A1B2E1T8
Position
complement(3557821..3558303)
Genome map
AA seq 160 aa AA seqDB search
MTIYDYEVTTITGEREKLEKYRGHVLLIVNTATKCGFAPQFSGLEKLHQTYRDQGLAVLG
FPSSQFMNQELEDNASIEEACKLNHGVTFPLFAKIDVNGTDAHPLYKHLTQEAPGVLGSK
AIKWNFTKFLVDREGKVVKRFAPADTPEKIEEHIKKLLQA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttatgattacgaggtaacgacaatcaccggcgaacgcgagaagctcgagaaa
tatcgcggccacgtgctgttaatcgtaaatactgcgaccaaatgcggattcgcccctcaa
ttcagcgggctggagaagctgcatcaaacgtaccgcgaccagggactggccgtgctcggc
ttccccagcagccagtttatgaaccaggagctcgaggacaatgcctcgatcgaggaagcg
tgcaaattgaatcacggggtgacctttcccctcttcgccaagatcgacgtaaacggcacc
gatgcccatcccctgtataagcatctgacccaagaagcgccaggcgtgctcggcagtaaa
gccatcaaatggaacttcaccaaattccttgtggaccgggaggggaaggtagtcaagcgg
ttcgccccggccgatacgcccgagaagatcgaagagcatatcaaaaagcttttacaggca
tag

DBGET integrated database retrieval system