KEGG   Paenibacillus ihbetae: BBD41_19995Help
Entry
BBD41_19995       CDS       T05154                                 

Definition
(GenBank) hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00860  Porphyrin and chlorophyll metabolism
pib01100  Metabolic pathways
Module
pib_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pib00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBD41_19995
Enzymes [BR:pib01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BBD41_19995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ANY76645
UniProt: A0A1B2E9J6
Position
4504681..4505364
Genome map
AA seq 227 aa AA seqDB search
MQVVLHLVRHGVTRWNQERRYLGHEDQGVISGELERLAPLARRLQGMHWGRVYCSDLLRC
RQTLRYLLTGNEVQSAALSGNTEALPLPGTVYDRRLRELHFGEWEGKTYEDLKGDPLYRR
WIEDPAAVTPPGGESWEAFSSRIQHFLAGMHQDLSRSCGKDENGEAGGRSSQKTPDLLAV
THGGVIRQIAAATVPDTPFWSLRILPGEELRLKLAWNGLGWQGEIMS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
ctgcaggttgtcctgcacctggtccgccacggcgttacccggtggaatcaggaacggcgg
tacctcggccatgaggatcagggcgtgatatccggggagctggaacggctggccccgctg
gcacggcggcttcaaggcatgcactggggacgcgtttactgcagcgacctgctcagatgc
aggcagactcttcgctatttgctgaccggtaacgaggttcaaagtgccgctttatctggc
aatacggaagcattgccccttccgggaaccgtgtatgaccgcaggctgcgcgagctccat
ttcggcgaatgggaggggaaaacctacgaggatttgaagggcgatcctttatatcgacgc
tggattgaggacccggcagctgtcactccgccgggcggagagagctgggaagccttctcg
tcccggattcagcattttttggcggggatgcatcaagatctaagccgcagctgtgggaag
gatgagaacggggaagccggaggacggagttcccaaaaaacgcccgacctgctggccgtc
acgcatggcggcgtgattcgccagattgcggcggctacggttccggacacccctttttgg
agcttgcgtatcctgccgggtgaggagcttaggctgaagctggcttggaacggactgggc
tggcaaggcgagatcatgagctga

DBGET integrated database retrieval system