KEGG   Paenibacillus ihbetae: BBD41_20360Help
Entry
BBD41_20360       CDS       T05154                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pib  Paenibacillus ihbetae
Brite
KEGG Orthology (KO) [BR:pib00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pib03009]
    BBD41_20360
Enzymes [BR:pib01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BBD41_20360
Ribosome biogenesis [BR:pib03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BBD41_20360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 GAD-like
Motif
Other DBs
NCBI-ProteinID: ANY76655
UniProt: A0A1B2E9K4
Position
4578885..4579898
Genome map
AA seq 337 aa AA seqDB search
MDSYYPPITYVISEHEEGMLLKTILQQRMGVSRKLLSRLKLTDKGIMLNGERVYISVKVQ
AGDVVEIRMEQERSDDILPQPMELDIVYEDEFILVLNKPAGIIVHPTHGHYTDTLANGVV
HYWQQKGWNYRFRAVHRLDQETSGVLVIAKNPYVHQHISEQMIAGTVDKRYVAFVHGQPE
PAEGDIDGPIDRDPLEPHRRIVTPSGYPSLTRYKVVAAYRGASLVELKLETGRTHQIRVH
MLSIGCPLIGDPMYRHPVYSQISAPEGAKASATDPSLPSLNEKVAKLDNTIGRQALHASS
ITLVHPMDGRAVKFSAPLPDDMNRLKERLCEAERARP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggactcgtattatccgccgatcacctatgtcatatccgagcatgaggagggcatgctg
ctgaagacgatccttcaacagcggatgggggtatcccggaagctgctctcccgtcttaag
ctcaccgataaggggatcatgctcaacggcgagcgcgtatatatcagcgtcaaggttcag
gctggggatgtcgtcgaaatccgcatggagcaggagcgttcggacgatatattgcctcag
ccgatggaactggatatcgtgtacgaggacgagtttatcctcgtactgaacaagccggca
gggatcattgtacatccgacgcatgggcactatacggataccctggccaacggcgtggtt
cattactggcagcaaaaaggctggaactaccggttccgggccgttcaccggctggaccag
gagacatccggagtgcttgtgatcgccaagaacccttatgttcatcagcatatatccgag
caaatgatcgccggaaccgtggataaaagatatgtcgccttcgttcatgggcaacctgag
ccggccgagggcgatattgacggaccgatcgatcgggacccgctcgagcctcaccggcgg
atcgttacgccgagcggctacccttcattgacccgctacaaagtggttgcggcataccgc
ggcgcttccttggttgaattgaagctggagaccggcagaacccatcaaattcgggtgcat
atgctaagcatcggttgcccgctgatcggcgatccgatgtaccgccatccggtctacagc
cagatatcggcgccggaaggggccaaagcctcagctacggacccgtcgctgccatcgctc
aatgagaaggtggcgaagctggacaatacaatcggaagacaggcgcttcatgcctcgagc
attacgctagtgcatccgatggatggacgggcggtaaagttctcggcaccgctgccggac
gacatgaatcggctgaaggagcggctttgcgaagctgaaagagcaagaccctag

DBGET integrated database retrieval system