KEGG   Paenibacillus ihbetae: BBD41_21555Help
Entry
BBD41_21555       CDS       T05154                                 

Definition
(GenBank) L-glutamate gamma-semialdehyde dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00250  Alanine, aspartate and glutamate metabolism
pib00330  Arginine and proline metabolism
pib01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pib00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBD41_21555
   00330 Arginine and proline metabolism
    BBD41_21555
Enzymes [BR:pib01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BBD41_21555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1612
Motif
Other DBs
NCBI-ProteinID: ANY74940
UniProt: A0A1B2E4P9
Position
4853424..4854971
Genome map
AA seq 515 aa AA seqDB search
MRTEFRNESFVNFKDDRNNAEFDRVLEQTEAGLGKEYPLIIGGERILTEIKAASINPANK
AQVVGVVSQADVQYAEQAIQAAAAAFETWKRTDPNERARYLFRAAAVLRRRRHEFSALMT
FEAGKTRVEADVETAEAIDFLEFYGREMQRLSQPQPLTVSQEEENELYYLPLGVGVIIPP
WNFPLAIMAGMTMAAVVAGNTVVLKPASPTPVIAAKFMALLEEVGLPAGVVNFVPGPGGE
VGDYLVDHPLTRFVSFTGSRDVGLRINERAAKTQPGQKWIKRVVAEMGGKDAIIVDQDAD
LDLAVDAITLSAFGFSGQKCSACSRVIVHEKVYDTVLERVVERASRLTIGAPSAAGTDVG
PVIDEKAYLKIQEYIEIGKQEGRLVLGGGTGDPNGFFIEPTIFADVDPNARISREEIFGP
VVAFTKAQSFDEALAFANNTDYGLTGAVISRSGANLEKARREFFVGNLYFNRKCTGALVG
THPFGGFNMSGTDSKAGGRDYLLLFTQAKLVAERF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgaattcaggaacgagtcgtttgtcaatttcaaggatgaccgcaacaatgcg
gaatttgaccgcgtgctggagcagacggaggccgggcttggcaaagagtatccgctaatt
atcggaggcgagcgcatcttgacggagatcaaggccgcttccattaatccggcaaacaaa
gctcaggtggtcggtgtcgtatcgcaggcggacgtacaatatgcggagcaggccatccag
gccgctgcggcggcctttgagacatggaaacggaccgatccgaatgagcgtgcgcgatat
ttgttccgtgcagcggctgttttgcgccggcgcaggcatgaattttccgctttgatgacg
tttgaggcagggaagacccgggtggaagcggatgttgaaacggcggaggcgatcgatttc
ctggagttctacgggcgcgagatgcagcggctcagccagccgcagccattgacggtcagc
caggaagaagagaatgagctgtattatctgcctttaggcgtcggcgtcattataccgcca
tggaattttccgctggcgattatggcaggcatgacgatggcggccgtcgttgccgggaat
accgtcgtcttgaagccggctagtccgacgcctgtcattgccgcgaaatttatggcgctg
ctcgaagaggtgggactgccggcgggcgttgtcaattttgttcccggaccgggcggcgag
gtcggcgattatctggttgaccatccgctgacccgctttgtcagctttacgggctcccgc
gatgtaggactccgcattaacgaacgggcagcgaagacccagcctggacagaaatggatc
aaacgcgtcgttgcggaaatgggcggcaaggatgcgatcatcgtcgaccaggatgccgat
ctcgatctggctgtggatgccattacgctgtccgccttcggattctccggccagaagtgc
tcggcttgctccagagtcatcgttcacgagaaggtctacgataccgtcctggagcgggtg
gtggagcgggcaagccggctcacaataggtgcgccgtcggcagccgggacggatgtaggc
cccgtgatcgacgagaaggcttacctgaaaattcaggagtacatcgaaattggaaaacag
gaaggacgtctggttcttggtggcggaacgggggatccgaacggattttttatcgagcct
acgatctttgccgatgtggacccgaatgcccggatttcgcgggaagaaatattcggtccg
gtggttgcgttcacgaaggcccaatccttcgatgaggcgcttgcgttcgccaacaatacg
gattacggcttaaccggagccgttatttcgcgcagcggggcgaatttggagaaggcaaga
cgcgagtttttcgtcggcaatctgtattttaaccgcaaatgcacaggcgccttggtcgga
acgcatccgtttggcgggttcaatatgtcgggtacggattcgaaagccggcggacgggac
tatttactgctgtttacccaagcgaagctggtagccgagcgattttag

DBGET integrated database retrieval system