KEGG   Paenibacillus ihbetae: BBD41_28200Help
Entry
BBD41_28200       CDS       T05154                                 

Definition
(GenBank) NAD-dependent epimerase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00053  Ascorbate and aldarate metabolism
pib01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BBD41_28200
Enzymes [BR:pib01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     BBD41_28200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind DapB_N NmrA Sacchrp_dh_NADP Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ANY76774
UniProt: A0A1B2E9X4
Position
6355468..6356244
Genome map
AA seq 258 aa AA seqDB search
MKRRVLITGAAGTIGSAIFKGLQQDHRYDVVGADIQADEMQGIIQMDIGDEARLVELTQG
IDTVIHFAWIKDEGDFLGKVLAGNVSGAYKLFEAAVKNGVRRMIFASSNHATGYYRTDEK
VGPHDPYRPDSFYGLSKCYIELLGRLYSDQGKISSFNIRIGNFPGDDRPHSERAGHIWIS
ERDMLQLIICCIEADDELKYLNLYGTSANSDNYYNIDYLEELIGYKPEDDATKLLELAKA
AGRSVRQDETIYQGGQQA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtagagtgttaattacgggagcggcaggtactataggaagcgcaatattcaag
gggcttcaacaggaccaccgatatgacgttgtcggagcggatatacaggcggacgaaatg
cagggcattatacaaatggatatcggtgatgaagcccggctggtagagctaacgcagggg
attgacacagtgattcattttgcctggatcaaagacgagggcgattttctaggaaaggtc
ctggctggcaatgtgagcggtgcctacaagttattcgaggcggcggtgaaaaacggcgtg
cgccgtatgatatttgccagctccaatcacgcaaccggatattacaggactgacgagaag
gttggtccccatgatccataccgtccggatagcttttacgggctcagcaaatgttatatt
gaactgctgggcaggctttactcggatcaaggcaagatctcctcgttcaatattcgtatt
ggcaactttcccggggatgatcgtcctcattctgagcgtgcgggtcatatctggatatcc
gagcgtgatatgcttcaattgatcatttgttgtattgaagctgacgacgagctgaaatat
ttgaatctgtacggtacatcagccaacagcgataactattacaacatcgattatctggag
gaactgatcggatacaaacctgaggatgatgcgacaaagctgcttgagctggccaaggca
gcaggacgcagcgtgcgtcaggatgaaacgatctatcagggcggacagcaagcgtaa

DBGET integrated database retrieval system