KEGG   Scheffersomyces stipitis: PICST_18249Help
Entry
PICST_18249       CDS       T01023                                 

Definition
(RefSeq) predicted protein
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
pic  Scheffersomyces stipitis
Pathway
pic04011  MAPK signaling pathway - yeast
pic04138  Autophagy - yeast
pic04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:pic00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PICST_18249
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    PICST_18249
   04139 Mitophagy - yeast
    PICST_18249
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PICST_18249
Protein kinases [BR:pic01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   PICST_18249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 4840844
NCBI-ProteinID: XP_001386411
JGI: 18249
UniProt: A3LZQ5
Position
8
AA seq 517 aa AA seqDB search
IYYGRSVNKVFNQDFIIDKRFKIVKELGHGAYGIVCSAKYDDGSGNDDITTNNNDAAGNS
SSSDGSYVAIKKITNIFSKKILCKRSLRELKLLQFFRGHKNITCLYDLDIIPNPLNGEFN
EIYLYEELMECDMHQIIRSGQPLTDSHYQSFIYQVLCGLKYIHSADVLHRDLKPGNLLVN
ADCELKICDFGLARGFSENPEQNAGYMTEYVATRWYRAPEIMLSFTNYSKAIDIWSVGCI
LAELLGGKPLFRGKDYVDQLNQILLVLGTPKEATLTKIGSVRAQNYVRSLPLMKKVSYSE
LFPNANPLALDLLEKMLTLDPFERISVEEALSHPYLAVWHDPQDEPECQVKFNFKSFETV
DNMDDMKQLIIDEVKKFREFVRKPIHEQQQIQLQIQLQQRQIEEQEAAAEAHRKEQLLEQ
QRQQQQQQQLQDQLNVMDIVETPAFSNNADVQYYQSIPKPQELDEFTFSHGSNSAAANDL
YENNSLQYQNSQTPAEFQNQSASDLFRLEEELGFGLD
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atatactacggacgatccgtcaacaaggtgttcaaccaagacttcattatagacaaacgg
ttcaagatcgtaaaggagcttggccatggagcctatggtatagtatgctccgccaaatac
gacgatggatccggcaacgacgacatcaccaccaacaataatgatgctgctggcaactcg
tcatcatctgatggatcgtacgtggccataaagaaaatcaccaatatcttttccaaaaag
atattgtgcaaacggtcgctccgtgagctaaagttgctccagttcttccgcggtcacaag
aacatcacctgcttgtacgatttggacatcattcccaatccgttgaatggtgagttcaac
gaaatctatttgtacgaagagttgatggagtgtgacatgcaccagattatccggtcggga
cagccactcaccgatctgcattaccaatctttcatctaccaggtgttgtgcggtctcaaa
tacattcatctggccgacgtgttacatcgggacttgaagccgggcaatctcttggttaat
gctgattgtgagttgaaaatctgtgacttcgggttagcccgaggcttctcggagaacccc
gaacagaatgccggttacatgacagaatacgtagctaccagatggtacagagcccctgag
atcatgttgagtttcaccaactactcgaaggctattgatatctggtctgtaggttgtatt
ttggctgaactcttaggaggaaagcctcttttccgcggaaaggactacgtagaccaattg
aaccagattctattggtattaggcactccgaaagaagccactttgaccaagatcggttct
gtgcgagcacagaactacgtcaggtcacttcccttgatgaagaaggtgagttatagcgag
cttttccctaacgctaaccctttggcacttgacttacttgagaagatgttgactcttgac
ccattcgagagaatttcggtcgaagaagcattgagccatccttatcttgccgtgtggcac
gatccacaagacgagcccgagtgtcaggtcaaatttaacttcaaatcgtttgaaacggta
gacaatatggacgacatgaaacaattgatcatagacgaagtaaagaagtttagagagttt
gttcgtaagcccatccacgaacagcagcagattcaattacagatccagttgcaacagcgg
caaatcgaagaacaagaagcagcagctgaagcccacagaaaggaacaattgctcgaacaa
cagagacaacaacagcagcaacaacaacttcaagaccaactcaatgtcatggatatcgtt
gaaactccggctttctccaataacgctgatgttcagtactaccagtcgattcccaagccc
caagagttggacgagttcactttctctcacggcagtaactcagctgctgctaacgacttg
tatgagaacaatagcttacagtaccagaatctgcagacgccagctgagtttcagaaccag
tctgcttcggacttgttccgtttggaagaagagttgggattcggtctagat

DBGET integrated database retrieval system