KEGG   Scheffersomyces stipitis: PICST_29213Help
Entry
PICST_29213       CDS       T01023                                 

Gene name
DUR5.2
Definition
(RefSeq) urea transport protein
  KO
K20989  urea-proton symporter
Organism
pic  Scheffersomyces stipitis
Brite
KEGG Orthology (KO) [BR:pic00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pic02000]
    PICST_29213 (DUR5.2)
Transporters [BR:pic02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   PICST_29213 (DUR5.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 4851942
NCBI-ProteinID: XP_001386945
JGI: 29213
UniProt: A3GI43
Position
1
AA seq 668 aa AA seqDB search
MSSASQSVELLGQGAGYGILVGVGALFAGGMILTTKLLQRYLHENSNSTETFAVANRSVG
TFLSASAVYSSWSWATELLWTSTMVYNYGIQASYYYGAGLAVQIAVMSVIGIHAKKKAPS
AHTSLEIVELRYGRVGHILYLFLGLANNLLSCASMILGASGAISIIAGNLHPVASTMLIP
FGVLLYTVVGGLKATFLTDFVHTLILLLVLCYLNTSVLTSDQIGGLDGLYNALVKKDGER
YIEGNFDGSILTGKSKGALFFGLILTAGNFGLTVLDSSFWQKTFSASPRATVPAYLIACF
FIFANVWPLGSIIGGASIVLEGTPGWPTYPREMTQYEIDSGFVLPYVLKQVLGNGGVGAL
LLVIYLAVTSTVSAQMISVSSILSFDIYKKYINPSAQNKQMIRISHISVVFFGLFCAAFS
VMLHYVGVNMTWLGYFIPMIICPGVLPLIFTITWDRQTTLAVVAAPISGFIFGISIWLST
AYHYYGEVTITSTGGQLPALFGSLTSLFLPGVVSIVISLFSSQKFDWSQLQQADLIIADD
TSIEEIVKNDGEVSSDINEKTSPVHTTVNDTGSKQEKPHQLSERELDFWIKISTGAAIFV
LLITWVLWPLPLYRDWKFTRAYFKGYVTVSLIWLYSALIVIGIMPLYGGRHSIARIFKGI
YRDFIKRS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgcttcccaatctgttgaattattgggccaaggtgccgggtatggaattttg
gtcggtgtcggtgcccttttcgccggcggtatgatcttgaccacaaaattattacaaaga
tatttacatgagaattccaattccaccgaaacttttgctgtggctaatagaagtgttgga
acatttctttcagcttcggcagtctactcatcctggtcttgggccacggaattgttgtgg
acgtctacaatggtgtacaactatggtatccaagcttcatattactatggtgctggttta
gctgtacaaattgccgtgatgtctgtgatcgggattcacgctaagaagaaggctcctagt
gcacacacatcgttagaaatagtcgaattgaggtatggaagagttggacatatactctac
ttattccttggattggcaaacaacttgctttcgtgtgcttccatgattcttggtgcatct
ggtgccatttccattattgctggcaatttgcacccagtcgcatccaccatgcttattcca
tttggtgtgttactttacactgtggttggtggattaaaggccactttcttgactgatttt
gtccatacattaatcttacttttggtgttatgttatcttaatacctcggttctcacttct
gaccaaatcggtggcttggacggcttgtacaacgctttagtcaagaaagacggtgaacgt
tacatagaaggtaacttcgatggttccatattgacaggaaagtctaagggtgccttattt
ttcggtttgattttaactgctggtaacttcggcttgactgtgttggattcttctttctgg
caaaagactttttcagcaagtccaagagcaacagttccagcttacttaattgcttgtttc
ttcatttttgcaaatgtctggcccttgggttcaattatcggtggagcttctattgtttta
gaaggtacaccaggctggccaacatacccaagagagatgactcaatatgaaatcgattct
ggtttcgttttgccatatgtattgaagcaagtgttgggtaacggaggagttggagctctt
cttttggtcatctatttggctgttacatccaccgtcagtgctcaaatgatttccgtgagt
agtattctttcctttgatatctacaagaagtacatcaatccaagtgctcagaacaaacaa
atgatcagaatctcacacattagtgtcgtattctttggtcttttctgtgctgcattctct
gtgatgttgcattacgttggtgtgaatatgacctggttaggttactttattccaatgatt
atctgtcctggtgttcttccattgatttttaccattacttgggatagacaaactactctt
gctgttgttgctgcccctatatctggatttatattcggcatttcaatctggttgtctact
gcttatcactactatggagaagttacaattacaagtaccggtggccaattgccagctttg
ttcggttctttgacttctttgtttcttccaggtgttgtatccatagtcatcagtttgttc
tcctcacaaaagttcgactggagccaattgcaacaagctgatcttattattgcagacgac
acttcaattgaggagatagtcaagaatgatggagaagtgtctagcgacataaacgaaaag
accagccccgttcataccaccgtcaatgatacaggctccaagcaagagaaacctcatcaa
ttgtctgaacgtgaacttgatttctggattaagatttctacaggtgctgctatatttgtt
cttttgatcacttgggttctctggccattaccgttatacagagattggaagtttacaaga
gcttattttaagggttatgtcactgtttctcttatttggctctactctgcattaatcgtc
atcggtattatgcctctctacggtggaaggcattcaattgctagaatctttaaaggaatc
tatagagacttcatcaagagaagctag

DBGET integrated database retrieval system