KEGG   Scheffersomyces stipitis: PICST_30460
Entry
PICST_30460       CDS       T01023                                 
Symbol
SMC5
Name
(RefSeq) structural maintenance of chromosomes protein
  KO
K22803  structural maintenance of chromosomes protein 5
Organism
pic  Scheffersomyces stipitis
Brite
KEGG Orthology (KO) [BR:pic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pic03400]
    PICST_30460 (SMC5)
DNA repair and recombination proteins [BR:pic03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     PICST_30460 (SMC5)
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_15 AAA_29 AAA_21 AAA_27 GSKIP_dom AAA_33 RNA_helicase HSBP1 AAA DAP_B RsgA_GTPase
Other DBs
NCBI-GeneID: 4837901
NCBI-ProteinID: XP_001383656
JGI: 30460
UniProt: A3LQV2
Position
3:complement(118225..121506)
AA seq 1093 aa
MTDIYQAIGDLRQYVGPNDSESVAKRRKVQSSRDFRPGSLMKLKLTNFNNYGSGEFNLSP
SLNMVIGPNGSGKSTVVSAICLGLGGKIDLIKRQTLSSMIKKGKSTASTEVTIKNFDGQP
PILVKREFTAKENRWYINHRPATEAKVKELRARFNIQLDNLCHFLPQERVAEFAGMSQEK
LLMETERTLGDGQLYRLHEDLIKNDTSRQDVTTRIEELEEKLSKFNEERSRLEADIKKLE
EYEGKTLEIEQHTKIIPYAQLSDLKKQRADLKRERDKAKSKLSKFLSSMDPLKDQHKEIE
TKVEMEKGLYSDIDDKQKEIRSRFINRKADLSKIKEEIGGLKSTVESLKSKSIKLQNQLK
KLEEKRHELISQRDLIVLPDKDEVEGYRKLRREVSEKKDEIGSKIEDLEDKIQEKQSSRK
EIMNNKKRVEQSLNSKDRLMVLSPRGGPPNSLRDGAYNAHKFLRDEAQLKDHYFESPVVC
CTVTNKTMAPHLEKVIDNNTLFSITTTNKQDFSMISSFQRKMKINFPIRLTTNSGTRNPR
IPKERLKQWGFECYLSDFLSGPGPVVDMIYDISKIQDIPVSRSGLSEEQIERLTMLDGNG
RYPFKKFISHDTLFVLTKSNYGSNQVSYTTEKVTGSRWFDSSGLTQEAKDFMNGQLQEFK
DRYNVLKGEEDGYLVEKQSLDSESRKLSAELEKYKNKIQHFTNETKNRAKIEGKLTALDA
QIKKTTKESTEDTSEQVDETEEKIKSKYLDYSNKLSELSIIGKESSDVAIELSLQSFRVL
QIRNREIAARNLIAKVEEQQVSLRKEYERLKAEYDQIKKGDAVKKIEEQSASYTPEERVL
LSRLAKAYMDAGNFSEQVIRDKISLLEDERSVMATADVSSIERLRRTLTEIDSLEKTLPR
LKDDKSKLDKRISDIQEAWEPELTKAIRNISLAFNKRFSRVASDGQVELAKAERFKDWKL
QILVKFRQESELKVLDHQSQSGGERAVTTIFFMMSLSGLTNSPFRVVDEINQGMDRKNEK
MAHRYLVDTACHSLSSQYFLVTPKLLTGLYYHPEMAVHCIYSGPLVDGTDRGNKEPDFMD
FKANSLAQKSIYT
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgacggacatataccaagccataggcgatttgagacaatatgttggtcccaatgattct
gaatctgtggctaagcgtaggaaagtacagagttctcgtgatttccgtcctggaagtctt
atgaagttgaagttgaccaatttcaacaactacggtagtggagagttcaatttgtctcct
tcactcaacatggttattggtcctaatggatctggtaaaagtactgtagtttctgcgatc
tgtttggggttgggtggaaagattgatcttattaaaagacagactctttcttccatgatt
aagaaaggaaagtccacagcttcaactgaagttacaatcaagaattttgatggtcaacct
cctattttagttaaaagagagttcacggcaaaagaaaaccgttggtatataaaccacagg
ccggccacagaagccaaagttaaagagttaagagctaggtttaacatccagttggacaat
ttatgtcactttttgccgcaagagagggtagctgaatttgctgggatgtcacaagagaag
ctacttatggaaacagaaagaactttaggtgatggccagttgtaccgtcttcatgaggat
ttgatcaagaacgatactctgagacaagatgtgactacaagaatagaagaacttgaagaa
aagttactgaaattcaacgaagaaagaagtagactagaagcagatataaagaagcttgaa
gagtatgaaggaaagactctagagatagagcaacacacaaagataattccgtacgcccaa
ctatctgatctcaaaaaacagagagcagatttaaaacgagagagagacaaagcaaaatct
aaattgtcgaagtttttatcttccatggaccctttgaaagaccagcataaagaaatagaa
accaaagttgaaatggaaaaaggactatattccgatatagatgacaagcaaaaggaaata
cggtctaggtttatcaatagaaaggcagatttatcgaaaattaaggaggaaatcggaggc
ttgaagtcaacggttgagtctttgaagagtaaatcgatcaaattgcagaatcaattaaag
aaacttgaagaaaaaaggcacgaattgatttcacaacgtgacttgatagtattacctgac
aaagatgaggttgaaggttacagaaaattgcgaagggaagtgtctgaaaagaaggatgaa
ataggaagcaagattgaagacttggaggacaaaattcaagaaaagcaatcgtcacgaaaa
gaaatcatgaacaataagaagcgagtagagcagagtttaaacagtaaagatagactaatg
gtcctttctccaagaggggggccgccaaactctttgagggatggggcatataatgcacac
aagtttctcagagatgaagctcagttaaaggaccattattttgagtcgcctgtggtttgt
tgtactgtaacaaacaaaacaatggccccacacttggaaaaggtgattgacaacaatacg
ctcttttcaattaccaccactaacaaacaagatttcagcatgatctcttcttttcaaagg
aagatgaagataaatttcccaattagattaacaaccaacctgggtacacgaaatccacgt
attcccaaagaaagattaaagcaatgggggttcgaatgctacttgtcagattttctttcg
ggtccagggccagtggtagatatgatatatgatatatcaaagattcaggatattcccgtg
agtagaagtggattatcagaagagcagatcgaacgattgacaatgctagatggaaacggg
agataccctttcaagaagtttatttctcatgatactctatttgtgttgactaaatcgaac
tatggtctgaatcaagtttcttatactacggaaaaggttactggatctagatggttcgat
tcatcaggattgactcaagaagctaaagatttcatgaatggtcagttacaggaatttaag
gacaggtacaacgttttaaaaggcgaagaagatggatatcttgttgagaagcaaagtctc
gattcagaaagtcgtaaactttcggctgagcttgagaaatataaaaataaaattcagcat
ttcaccaatgaaacgaaaaacagggcaaaaatagaaggaaagttaacggctcttgacgcg
caaatcaaaaagacaacaaaggaatctacagaagacacaagtgaacaagttgacgaaacc
gaagagaagatcaaatcaaagtatttggattattcaaacaagttatcggagcttagtatc
attggtaaggaatctagcgatgttgctattgagctaagtttgcaatcatttagagtgctt
caaatcagaaacagagagatcgcggcccggaatctaattgctaaagtagaagaacaacaa
gtttcattaagaaaggagtatgaaagattgaaagcagaatatgaccaaattaagaagggg
gatgctgttaaaaagatcgaagaacagagtgcttcgtacactccggaagaaagagtacta
ttgtctaggcttgccaaggcatatatggatgctggtaacttctcagaacaggtgataaga
gacaaaatactgcttttagaagacgagcggtctgtgatggctactgctgatgtgagttcc
atcgaaagattacggaggaccttgactgaaattgattcactcgagaagactcttccaagg
ttgaaggacgacaagtctaaattggacaaaagaattagtgatattcaagaagcatgggaa
ccagagctaactaaggcaattcggaatatttcattagcatttaacaagcgattctccaga
gtcgcaagcgatggacaagtagaattagccaaagcagaaagattcaaagattggaaattg
caaattctagttaaatttagacaagagtcagagctaaaggttttggaccaccaatcacaa
tctggaggggaaagagcagtaacaactatctttttcatgatgtctttgctgggattaaca
aattctccatttagagttgtggatgaaatcaatcaagggatggatcgaaagaatgaaaag
atggctcacaggtacttggtggacacggcctgccatagtttgagttcacagtatttcttg
gtcactcccaagcttttgacaggtctctattatcatcctgaaatggcagttcattgcatt
tattctggtcctttggtcgacggaacagatagaggaaataaggaacctgatttcatggac
ttcaaagcaaattcattagcgcagaaatctatatatacatga

DBGET integrated database retrieval system