KEGG   Scheffersomyces stipitis: PICST_31021
Entry
PICST_31021       CDS       T01023                                 
Symbol
RHC18
Name
(RefSeq) Protein involved in recombination repair
  KO
K22804  structural maintenance of chromosomes protein 6
Organism
pic  Scheffersomyces stipitis
Brite
KEGG Orthology (KO) [BR:pic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pic03400]
    PICST_31021 (RHC18)
DNA repair and recombination proteins [BR:pic03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     PICST_31021 (RHC18)
SSDB
Motif
Pfam: AAA_23 AAA_15 SMC_N AAA_21 ATG17_like AAA_29 AAA_13 ABC_tran
Other DBs
NCBI-GeneID: 4837941
NCBI-ProteinID: XP_001383583
JGI: 31021
UniProt: A3LSE0
Position
3:1541465..1544656
AA seq 1063 aa
MTQNGPDSEEESSDSDSESESSSSDSDDDEITDASPAKAGVIERISLKNFMCHDSFELEL
GPQINFIIGRNGSGKSAILTGISVGLGAKASDTNRGTSIKSFIKDGKSTARVTIVFLNEG
PEAYRPEEFGKRIIIERKLQRIGGNTYAIRSHSGRTISTKKATLDEILYKFSITIDNPLA
FLSQDKAREFLMNTSDEQKYSLFMSGAFITNIIDNFGRTSKNIAEINSKIVQAQHYRKAC
KDSYNEIASIYNRHKKSDYLRNKLQMLYGKILWYNVTTIEKKVNSYEEQAISLKEEIKSA
DDKIVECNEFIENAPEEIAVLEKDLTDKELSLDDLSEKHSKTNDTRQDAKNTSSQLLEEC
KENAKVIQSLQEKIETRTKDIEKEQRKIDEINGGSREKLRLEYDELSAEIQNIEEQLTGI
KRTIEITKSSANPNMDSHKSTLKDRMSQLESLQKRRQDSQRAQKDRYFAWGREMSNVIQR
IRSTNTWHKLPIGPLGADVEVKSEYSKWSALINTVLNRMLDSFIVCDEHDRRLLESILAH
YSMKKTIIVRKFESFDFSNGKVSGHPTFVDMITCKNEEVLRALVDSMNIEKLVISDKNES
PSSILNERNVMSVFTLSTVNSGTRYGKAGDTIRMDPVYYSKDIVKLAVTGADELHDVVSL
ISEEKLQIDILQKRLREMQSHHQNEIVNLEKKKNEFNEVIRRKKRKLDEIESKINEEGDL
SNIEKYKSEIEAHKDQIKTREGVIEALTEDLESRNEILKKLKESVKELKVQLTEATAARD
RAKKNLHDYEVELSTNKDNRVSYLSEKKKIETQLEKTNAKIEEGNNKLQQLIDEAEKKCR
REEVTITSNDTQDSIRDEYALVQTQVKEAEKQIGKPFEEIQNDLIEAKERQRLAEESLKN
LSRTYKSLDSDLKIRFNFVHTTILSSVEQASRTFENCMALRGFKGSLSFDHGERKLTLLA
QTKSDDKQREVTSLSGGEKSFAQISLLLSIWKVMDSKIRGLDEFDVFMDSVNRSISIKLL
LNELRQYPKSQNIFITPQDIAVVGDLNSSDVKIHKMSDPRKDT
NT seq 3192 nt   +upstreamnt  +downstreamnt
atgacacagaatgggcctgattctgaagaggaaagctcagattcagatagtgaatctgaa
tcgtcatcttctgattctgacgacgatgaaatcacagatgcatccccggctaaagcaggc
gttatcgagcgaatctcgctaaagaatttcatgtgtcacgattcgtttgaactcgagctt
gggccccaaatcaactttatcattggaagaaatgggtcaggaaaaagtgccattttgacc
ggaatatctgtcggactaggagcaaaagcttccgacactaatcgtgggacgtccatcaag
tcgtttattaaagacgggaaatcaacagcgagagtcacgatagtatttttgaatgagggc
cccgaagcatatagacccgaggaattcggcaagaggattattatagagaggaagctccag
cgaattggaggaaatacctacgccatcagatcgcattctggtaggacgatttcgaccaag
aaagccactctagacgaaatcttgtacaaattcagcatcactatagacaaccccttagca
tttttgtcacaagataaggctcgtgaatttttgatgaacacttcagacgagcagaaatac
agtcttttcatgtccggagcatttattacgaacattatagacaattttggcagaacactg
aagaacatagctgaaatcaattccaaaattgtgcaagcacaacattatagaaaggcatgt
aaagatagctacaacgagattgccagcatatacaaccgacacaagaagtctgattacttg
agaaacaaacttcagatgctttatgggaaaatcctctggtataatgtgactacaatagag
aaaaaggtaaattcatacgaggaacaagctatttctttaaaagaagaaatcaaatctgca
gacgataagattgttgaatgcaacgaatttatagagaatgcaccagaagagatagctgtg
ttggagaaagaccttacagataaggagttatctctagatgacttactggagaagcattcc
aagaccaacgacaccaggcaagatgcaaagaatacaagtagccaattgttggaggagtgt
aaggaaaatgcaaaagtgatccagtctttgcaagaaaagatagagacaagaaccaaagat
atcgagaaagagcaacgaaagattgacgaaataaatgggggatcaagagaaaagctaaga
ctagaatatgatgaattgagtgcagaaatacaaaatatcgaagagcaactaactgggata
aaaagaactattgaaattacgaagtcttctgcaaaccctaatatggacagtcacaagtcc
acacttaaagatcgtatgtctcaactagaatctcttcaaaagagaaggcaagattcccaa
cgggcccagaaggacaggtattttgcatggggcagggaaatgagcaatgtaatacaaaga
attcgaagtacgaatacctggcacaaactaccaattggaccattgggagccgatgtagaa
gtgaaatcagaatacagcaagtggagcgctttgataaacacagttcttaatagaatgctc
gactcgttcatagtctgcgatgagcacgacagaagactattggaaagtatactagcgcat
tattcgatgaaaaaaaccattattgtcaggaagtttgaaagttttgacttttccaatggt
aaggtgtctggacatcctacttttgtagatatgataacatgcaagaatgaagaagtattg
cgagcattggttgatagtatgaatatcgagaaacttgtcatcagtgataaaaatgaaagc
ccatcgtcaattcttaacgaaagaaacgtaatgagtgttttcacactatcaactgtcaat
tctggtactcggtacggtaaagcaggagatactattcgaatggatcctgtttactattcc
aaggacattgtaaaattagctgttacaggagctgatgaacttcatgatgtagttagctta
atctcggaggaaaagcttcagatcgacatactacagaaaagacttcgagagatgcaatcc
catcatcagaatgaaatcgttaatcttgaaaagaaaaagaatgaattcaacgaagttatc
agaagaaagaagcggaaattggacgaaatagaatctaagattaatgaagaaggtgatctt
tccaacatcgagaaatacaaaagtgaaattgaagcacacaaagaccaaatcaaaactagg
gagggggttatagaggcgcttacggaagacttggagtcccgaaacgaaatcttgaagaaa
ctaaaggaaagtgttaaagagcttaaagttcagttaaccgaagctacagcagctagagat
agagcaaagaagaacttgcatgattatgaggttgaactttctacaaacaaagataataga
gtgagttatttgtccgaaaagaaaaaaatcgagacccaattggaaaagacaaatgctaaa
atagaagaaggaaacaacaaactccaacagttgattgatgaggcagagaagaaatgcaga
agagaggaagtgacgatcacttccaatgacacgcaagattccattcgtgatgaatatgct
ctagtacaaacacaagtcaaagaagcagagaaacagattggcaaaccattcgaggagatc
cagaatgatttgatcgaagcaaaagaaaggcagagattagcagaggaaagtttaaaaaac
ttgtccaggacttataagagcttggattcggatttgaaaatcagatttaatttcgttcat
accactatattgtcaagtgtcgaacaggcttccagaaccttcgaaaactgtatggctctt
agagggtttaaaggctcacttagttttgaccatggagagagaaaattgactcttcttgcc
caaacgaaaagcgacgacaaacaacgtgaagtgacctcgttgtccggaggtgagaaatcg
tttgcccaaatctcgttgttgttgtcaatttggaaggttatggattccaagattcgggga
ttagacgaattcgatgtctttatggattccgtgaacaggtccatcagtatcaaactcttg
ttgaacgaacttagacagtatccgaagtctcagaacatctttattacacctcaggatatt
gccgttgttggtgatttgaatagtagtgatgtaaagattcataagatgtctgatccgaga
aaagacacttga

DBGET integrated database retrieval system