KEGG   Scheffersomyces stipitis: PICST_35590Help
Entry
PICST_35590       CDS       T01023                                 

Gene name
ALK2
Definition
(RefSeq) n-alkane inducible cytochrome P- 450
  KO
K00493  unspecific monooxygenase [EC:1.14.14.1]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00071  Fatty acid degradation
pic00380  Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    PICST_35590 (ALK2)
  Amino acid metabolism
   00380 Tryptophan metabolism
    PICST_35590 (ALK2)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     PICST_35590 (ALK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF4751
Motif
Other DBs
NCBI-GeneID: 4838296
NCBI-ProteinID: XP_001383506
JGI: 35590
UniProt: A3LS01
Position
3
AA seq 523 aa AA seqDB search
MANFIEFVTTNWYIIIPALLVLHKVFDLLYVQYLYRKLGAKPCTNQTDDHAFGIRAGFEM
LKKKNEGTVVDFGAERFESRIDPKIPTFSMRLFLIPIVLTRDPENIKALLATQFNEFVLG
SRFEQLAPLLGKGIFTLDGEGWKHSRAMLRPQFAKEQVAHVQSLEPHIQALAKHVRNAKG
KSFDIQELFHRLTVDSATEFLFGQSVESLRDESVGMADEATDFAGKSTFAASFTIAQNWL
ANRAVAQKFYFLINPKEMRDSIKDVHRFVDYYVQVALDTPQDELDKKSKDGYIFLYELVK
QTRDPYVLRSQLLNVLLAGRDTTAGLLSFAFFELARRPDIWSKLKDEIYENFGSGENSKV
DEITFESLKRCEYLKAFLNETLRLYPSVPVNFRVATKDTTLPRGGGKDGSEPILVRKGQS
VFYSVYATHRSEAYYGKDRHVFRPERWFEPSARKLGWAYLPFNGGPRICLGQQFALTEAS
YVVARLIQLFPNIENYEPEEVYPPFKNSQLTMNLLNGLHIGLY
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattttattgaattcgtcaccaccaactggtacatcatcattccagcacttcta
gtgttgcacaaggtctttgacctcttgtatgttcagtatttgtacagaaagcttggagca
aagccttgcaccaaccagacagatgaccatgcttttggtattcgtgctggatttgaaatg
ttgaagaaaaagaacgaaggaactgttgtagactttggtgcagaaagatttgaatcccgc
atcgaccccaagatcccaaccttttccatgagattgttcttgattccaattgtgcttacc
agagaccccgaaaacataaaggcattattggccactcaattcaacgagttcgtattaggc
tctagattcgaacagcttgccccattgttgggtaaaggtattttcacgttggacggtgaa
ggctggaagcattccagagccatgttgagaccacagttcgctaaggagcaagttgcccat
gtgcaatctttggaacctcacatacaagccttggccaagcatgttcgtaacgccaagggc
aaactgtttgacatccaagaattgttccacagattgactgtcgactctgccactgaattc
ttgtttggtcaatctgttgaatcattgagagacgaatctgttggtatggccgatgaagct
acggacttcgcagggaagagtaccttcgccgcttcgttcaccattgcccaaaactggttg
gctaacagagccgttgcccagaagttctatttccttatcaaccccaaagaaatgcgtgat
tctatcaaagatgttcacagatttgtcgattactacgttcaggtcgcattggacactcct
caagacgaattggacaaaaagtccaaggacggttacatcttcttgtacgaattggtgaaa
cagactagagatccatacgtgttaagatcgcagttgttgaacgtcttgttggctggccgt
gacaccaccgccggtttgttgtcatttgctttcttcgaattagccagaagaccagatata
tggagcaagttgaaggacgaaatctatgagaatttcggcctgggtgagaactccaaagtt
gacgagattactttcgaatcgttgaagagatgtgaatacttgaaggcattccttaacgaa
accttgagattgtacccatctgtccctgttaacttcagagttgctactaaggacaccacc
ttgccaagaggtggtggtaaggatggtagtgagcctattcttgtcagaaagggccagtct
gtcttctacagtgtctatgccactcacagaagcgaagcatactacggcaaggacagacat
gtgttcagacctgaaagatggttcgagccttctgctaggaagctcggctgggcttacttg
ccattcaatggtggtccaagaatctgtttgggtcaacagttcgccttgactgaggcttcg
tacgttgtcgccagattgattcaacttttccctaacattgaaaactatgaaccggaggaa
gtttacccaccatttaagaactcccaattgaccatgaaccttttgaacgggttacacatt
ggcttatactag

DBGET integrated database retrieval system