KEGG   Scheffersomyces stipitis: PICST_43263Help
Entry
PICST_43263       CDS       T01023                                 

Gene name
YXE1
Definition
(RefSeq) hypothetical protein
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00660  C5-Branched dibasic acid metabolism
pic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    PICST_43263 (YXE1)
Enzymes [BR:pic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     PICST_43263 (YXE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD SpoVIF
Motif
Other DBs
NCBI-GeneID: 4838229
NCBI-ProteinID: XP_001383451
JGI: 43263
UniProt: A3LRP8
Position
3
AA seq 481 aa AA seqDB search
MDLSLPYDRKINSRSVTTELSEWVAQLKWEDVPDKIKDRTKFLILDGIGCALVGAHLPWS
EEAVEAVLKFETPGGDSPIVGWKGRKTGLVSAALLNSTFIQGFELDDYHSYAPLHSNSII
LPTLLSLCSKDPSKHSGRDFILATIVGFEVGPRVGKSIGGSSILSLGWHSGAVFGPPVAA
ASACKFLSHNAIQIEDAFGIACTQASGLMSAQFESSVKRMQHGFAVRNGLFAALLADSNY
KGISKVFERKYGGYIPVFTLGGLKPKPEEISLGLGEIWRIEGTLVKLHPCMGGIHSTCEC
VEELVNSQEVDSKNIEGVKIELGKAAFHHGGWKAQRPINVIGAQMNNSYIAASIFVDGSL
QMKSFTEDKLNREEVWDIVKKTQCVENNFEGQIDPQFKLCTQVTVTTKDGKEHISRVVNP
KGVLPPLTGKEIVEKFKNLTNNVITKDQQDKIIETVLNLDKFDMSCLLDSLDIDTSNPLA
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggatttgtctttaccatatgataggaagataaatagcagaagtgtaaccacggagctt
agtgaatgggttgcccaacttaaatgggaagatgttccagacaaaattaaggatagaaca
aaatttttgatcttagacggcattggatgtgccttagtaggtgctcatttgccatggtct
gaagaagcagtcgaagcagttttgaaatttgaaaccccaggaggagattcaccaatagtg
ggctggaaaggaagaaagacggggcttgtctcagcagctttactcaattccacattcatt
caaggtttcgagctcgatgactaccacagttacgctcctttacattccaattctataatt
ttgcctacacttttgagtttatgttctaaagatcccagcaagcattcagggagagacttt
atcttagcaacaatagtcgggttcgaagttggaccaagagttggcaaatcaattggggga
agttctattctctcgcttggttggcacagcggtgctgtcttcggtccacctgtggccgct
gcgtctgcctgtaaattcttgagccataacgccattcaaattgaagatgcttttggaata
gcttgtacccaagcgtctggtctcatgtcggcacaatttgagtcttctgtgaaacgaatg
caacacggttttgctgttaggaatggcctattcgcagcgttattggcagattcaaattac
aaagggatttcaaaggtctttgaaagaaagtacggtggctacattccagttttcactttg
ggtggtttgaaacctaaacctgaagagatatccttaggcttaggtgaaatttggagaata
gaaggtaccttagtgaaactacacccttgcatgggagggatccattccacatgcgaatgt
gtagaagaactagtcaatagccaggaggttgattctaaaaatattgaaggagttaaaatt
gaattaggtaaagcagcttttcatcatgggggctggaaagcacagagaccaatcaatgtt
attggtgcacagatgaataactcatacatcgccgcatctatatttgttgatgggtcactt
caaatgaaatcttttaccgaagataaattgaaccgtgaagaagtttgggatattgtaaag
aaaactcaatgtgtagaaaacaactttgagggccaaattgaccctcagttcaaattatgc
actcaagttacagtaacgacgaaggatgggaaagagcatatatcgagggttgtcaatcca
aagggagtgttgcctccattaaccggaaaagaaattgtcgaaaaatttaaaaatttaact
aacaatgttattactaaagaccagcaggataaaattatcgaaacagttttgaatttggat
aaattcgacatgtcttgtctattagactccttggatattgacactagcaacccgcttgct
gtctaa

DBGET integrated database retrieval system