KEGG   Scheffersomyces stipitis: PICST_47651Help
Entry
PICST_47651       CDS       T01023                                 

Definition
(RefSeq) predicted protein
  KO
K10739  replication factor A2
Organism
pic  Scheffersomyces stipitis
Pathway
pic03030  DNA replication
pic03420  Nucleotide excision repair
pic03430  Mismatch repair
pic03440  Homologous recombination
Module
pic_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:pic00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PICST_47651
   03420 Nucleotide excision repair
    PICST_47651
   03430 Mismatch repair
    PICST_47651
   03440 Homologous recombination
    PICST_47651
DNA replication proteins [BR:pic03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    PICST_47651
DNA repair and recombination proteins [BR:pic03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     PICST_47651
   MMR (mismatch exicision repair)
     PICST_47651
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     PICST_47651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_anti-codon RPA_C RMI2
Motif
Other DBs
NCBI-GeneID: 4840224
NCBI-ProteinID: XP_001385638
JGI: 47651
UniProt: A3LYC8
Position
6
AA seq 247 aa AA seqDB search
MADFYDGEFSGGFTTENAPNSQSEPRTRTSLTPVTIKQINDATQPIPDGNFKVNNVELNM
ISFVGIVRSVDSLPSAISVTIEDGTGTTNVRKWVDENSGTPAEAEEKYRMYLDKYVYVTG
ALKSMSNKSYIQNASVMPVKDHNQVLSHVLSAIHHHLLAQGIKPRPKDEKSLFVSESAST
SAPQLSIKERIMKVVRDHSPSMVEGVPPRLISQIVGIGQDEVTKICTELVDRGELYGGSD
DNTYLLD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttctacgatggcgaattcagtgggggtttcacgactgaaaatgctcctaac
tctcagtctgaacccagaaccagaaccagtttgactcctgttactattaaacagattaat
gatgctacacagccaatcccagacggcaattttaaggtcaataacgtagaattaaacatg
ataagctttgttggaattgtgcgtagtgttgatctgttgccctcagctattctggtgaca
atcgaagatggcaccggtacgactaatgtcagaaagtgggtagatgaaaactccggaaca
ccagctgaggccgaagaaaagtaccgcatgtaccttgataaatatgtctacgttacaggt
gcattgaagtcaatgtccaacaagagttacattcaaaatgcactggtcatgcctgtaaag
gaccataaccaggtcttgtcgcacgtgttaagcgctattcaccatcacttgcttgctcag
ggaatcaagccacgccccaaggatgaaaagctgttgtttgtttccgagtcggcatcgacg
tccgcaccccaattatctatcaaagaacgtataatgaaggtggttagggatcacagtccg
ctgatggtggaaggtgtgcctccaagattgatttctcagatcgtggggattggccaggac
gaagtcaccaagatttgcacagaattggtggatagaggcgaactatacggaggcctggac
gacaacacatatctcttagattaa

DBGET integrated database retrieval system