KEGG   Scheffersomyces stipitis: PICST_49619Help
Entry
PICST_49619       CDS       T01023                                 

Definition
(RefSeq) predicted protein
  KO
K15529  ADP-ribose 1''-phosphate phosphatase [EC:3.1.3.84]
Organism
pic  Scheffersomyces stipitis
Brite
KEGG Orthology (KO) [BR:pic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PICST_49619
Enzymes [BR:pic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.84  ADP-ribose 1''-phosphate phosphatase
     PICST_49619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro MCC-bdg_PDZ HTH_Crp_2
Motif
Other DBs
NCBI-GeneID: 4840631
NCBI-ProteinID: XP_001386165
JGI: 49619
UniProt: A3LZD1
Position
7
AA seq 173 aa AA seqDB search
MIRYIKGDLLGHLPPSKSSVAVFAHACNCQGVWGGGIAAVLRVKFPSTYPLYSGHCQEKG
CDPHRLLGTSVVVPSQASDPGNIAGYPPKYIACLFTSDFAQTQEEIVAYTDSAIEALVDQ
LKELQKTTAIETGQSGKIVVNMPKINAGIFAVPWEKTEAVLKKYDVEFNVYVI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgattagatatataaagggtgatttgttaggtcatcttccaccaagcaagtcttcggtt
gctgtctttgctcatgcttgcaattgccagggtgtctggggaggaggaatcgctgctgtg
ctcagagtgaaatttccttctacctatcctttgtattctggtcattgccaggaaaaagga
tgtgatccacatagacttttgggaacatctgtcgtagtgccctcacaagctctggatccg
ggaaacatcgctggatacccccctaaatacatcgcctgtttgttcaccagcgactttgcc
cagacccaagaggagattgtagcatatacagattctgccatagaggcactcgtggatcaa
ctaaaagaattacaaaagacaactgcaattgagaccggacaaagcggtaagatcgttgta
aatatgcccaagatcaatgctggaatctttgctgttccttgggagaagactgaagccgta
ttgaagaaatacgatgtggagtttaatgtttatgttatatga

DBGET integrated database retrieval system