KEGG   Scheffersomyces stipitis: PICST_57025Help
Entry
PICST_57025       CDS       T01023                                 

Gene name
SCW4.2
Definition
(RefSeq) cell wall glucanase Probable family 17 glucosidase SCW4 precursor (Soluble cell wall protein 4)
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00500  Starch and sucrose metabolism
pic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PICST_57025 (SCW4.2)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     PICST_57025 (SCW4.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_17
Motif
Other DBs
NCBI-GeneID: 4838023
NCBI-ProteinID: XP_001383372
JGI: 57025
UniProt: A3LR99
Position
3
AA seq 303 aa AA seqDB search
SGSGSSVSSGSSSVVGAASISGTPTSPRTGTVNGGSISAADGSLGITYSPYTKSDACKSA
SEVASDIAKLSNFKIIRLYSTDCSGIENVLAAINSNQQVFLGIWGIDSGSVTSGLQDITT
AVEGSSRGWGAVHTIAIGNERVNDGAATPSDIQSAINTAKSWLKSNGSGYTGPIVSVDTL
VAVVSNPSLCSYSDYIAVNSHPYWDGGVQPSNSGPWLVDQINNLKSVCGSSKPIMITETG
WPTKGDTNGVCVPSVANQEAALQSIVSTLGNQVIAFTMYNDYWKSPGSMGVEQYWGIFGD
PSE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
tccgggagcggtagttctgtctccagtggatcttcttctgttgtcggcgcagcttctatc
agcgggactcccacttccccaagaactggaacagtcaacggaggtagtattagtgctgcc
gatggttccttgggaatcacatactctccatacacaaagtcagatgcttgcaagtcagcc
ctggaagtcgcttcagacattgctaagttatccaacttcaaaatcatcagattatattcc
actgactgttctggaattgagaacgtcttggctgctatcaacagcaaccaacaggttttc
ttaggaatctggggtattgactccggttctgttaccagcggattgcaagacattaccaca
gctgttgagggctcttctcgtggatggggtgctgttcataccattgctattggtaacgaa
agagtcaacgatggagcagctactccttccgatatccaaagtgctatcaacactgccaaa
tcatggctcaaaagcaatggttccggatacacaggtccaattgtttccgtggacacattg
gtagctgttgtcagcaacccatcattgtgtagctattctgactacattgctgtcaactct
cacccatactgggacggaggagttcaaccaagcaactctggaccttggttggtagaccaa
atcaacaacttgaagagtgtttgcggttctagcaaacccatcatgatcactgaaacaggg
tggcccaccaaaggagatacaaatggtgtttgcgtaccttcagtggctaaccaagaagca
gctttacagagtattgtgctgactttgggaaaccaggtgattgccttcacaatgtacaat
gactactggaaatcgccagggtctatgggtgttgagcaatactggggtattttcggtgac
cccagtgaatag

DBGET integrated database retrieval system