KEGG   Scheffersomyces stipitis: PICST_57110
Entry
PICST_57110       CDS       T01023                                 
Symbol
FUN30
Name
(RefSeq) helicase of the Snf2/Rad54 family
  KO
K14439  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 [EC:5.6.2.-]
Organism
pic  Scheffersomyces stipitis
Brite
KEGG Orthology (KO) [BR:pic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pic03036]
    PICST_57110 (FUN30)
Enzymes [BR:pic01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     PICST_57110 (FUN30)
Chromosome and associated proteins [BR:pic03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    PICST_57110 (FUN30)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII DUF5577
Other DBs
NCBI-GeneID: 4837990
NCBI-ProteinID: XP_001383600
JGI: 57110
UniProt: A3LSI2
Position
3:1645541..1648939
AA seq 1093 aa
MSWYKKDRPGIRPETEKTPKKENYVQVPSSSPIQIKSSPQQPSLLPPSLNSKYSLSEKER
QLETKRQAIRQHKDFSVVRKRFYYLKESDIFKGFVKGKGNLREITQWLTDNYNKAEILGK
EEEERRRQRDEAERVKQKQLEDRMKHEYEKREELGISDDDDDVEEVDDVDDEDEDDDEDS
LPIKMRGRVGIKREDRSPTKDAIRHTFSSQEHSTKVVSSKPRVSILDKYKFKSKSQPTLD
HFRGASDLQPKRRKLVRASALEDDSASSSATGSPMSAPNSLAASFAYQSDSVPKMKKTIL
ADNDDDLSDMIVADDDLERLEEKIKQNIKAKRAQKNEIVTVSDDELEEDDISDDMSEEDD
ENNYQTGITSIDNQILEFLNDAPVDDLIEICTLEPEVAKFVISQRPFNTIYDVSENNFEP
EDEAKAKNSSRRRKTLGLRIIESTEFSLKGYKAVDSLIKTCSKYGTSISNQINTWGVTTT
GQGELSVTDIDPADDEVKEIIDLDEENDDDEEEVVVTHYKKKGLRYIKHKPALLADEITL
NNYQQVGINWLNLLYQNRLSCILADEMGLGKTCQVIAFMAHLKQTEEKKGPHLVVVPAST
LENWLREFNKFCPDLKVQAYYGTVKEREDLRYELREIDFDVLVTTYTLAAGSPLDFKFLR
SQNFNIIVYDEGHFLKNSGTERYNRLMKLQAKFRLLLTGTPLQNNLKELVSLLSFMLPKL
FNEKKEDLQGLFNQKMGKVTSSSKSDNYNPLLSIQAIRKAKTMMTPFVLRRRKDQVLQHL
PAKCHEIVKCDLSKDQRSIYDELYNKAKSTRSERERRKLLSSKEQVELNKKQPIESSSNV
LMALRKASLHPLLFRIQYTDEKLAKMAKAIMNEPEYVEANQTYIFEDMQVMSDYELNNLC
AKFPKTMSPYKLNEDAFLNSGKVLELQKTLKLIIEGRQEKVLIFSLFTQVLDILERVLTQ
FKYKFVRLDGATSVESRQDIIDEFYDDETIPIFLLSTKAGGFGINLIAANNVIIFDQSFN
PHDDKQAEDRCHRVGQKKEVTVYKLIVNDTVEENMLKLAENKLQLDQTISAEGAEEAKFE
EKAASLFEKLLFE
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgagctggtacaagaaagatcggcctggaatcaggcccgagaccgagaaaactcccaaa
aaggaaaattatgtccaagttccactgtcttcgccgattcagatcaagtcgtcaccacaa
cagccttcacttctaccaccatctcttaatagcaaatatctgttaagcgaaaaagaacgc
cagctagaaactaagagacaggctatcagacagcacaaagatttttctgtcgttcgcaaa
cgtttctactatctcaaagagagtgatattttcaaaggctttgtcaagggcaagggaaat
ctccgtgaaatcacccaatggcttactgacaattacaacaaagccgaaatcctaggaaag
gaagaagaggaacgtagacggcagcgcgatgaagcggaaagagtgaaacagaaacagtta
gaagaccgtatgaagcatgaatatgagaaacgcgaagagcttggaatctcagatgatgat
gacgacgtcgaagaagttgatgatgtagacgacgaagacgaagacgatgacgaagattct
ttgcccataaaaatgcgtggaagagtcggaataaagcgggaggaccgatctcctacaaag
gatgcgattcgtcacacattcagctcccaggaacacagcaccaaagttgtcagcagtaaa
cccagggtttccatcttggataaatacaagttcaagtccaagagccagcctacactcgac
cacttcagaggagccctggatctccagcccaagagacgtaaacttgtcagagcctcagct
ttggaagacgattctgcctcttcttcagccacaggctcaccaatgtctgctccaaactcg
ctagctgcgtcgtttgcctatcagtcagacagcgtacccaaaatgaaaaagacaatacta
gcagacaatgacgatgatttgagcgatatgattgtagcagacgatgacttggagcgttta
gaagaaaagatcaaacagaacatcaaagccaagcgagctcagaagaacgaaatcgtcact
gtcagtgacgacgaacttgaagaagatgatatcagtgacgacatgtcagaagaagacgac
gaaaacaactaccaaactggtattacttctattgataaccagatcttggagttcttgaat
gatgcacctgtggacgatttgattgaaatctgtactctcgagccggaagttgcaaagttc
gtcatcctgcaaagaccattcaacacgatatacgatgtttctgaaaataattttgaacca
gaagacgaagctaaggctaagaacagcagcagaagaagaaagactctaggcttgagaatc
atagaaagcaccgagttttccttaaagggctacaaggctgtagattcgctcatcaaaacc
tgttccaagtacggtacttcaatctctaaccaaattaatacttggggtgttactactacc
ggacagggtgagttatctgttactgatatagaccctgctgatgatgaggtgaaggaaatt
atagatttagacgaagagaacgatgacgacgaagaagaggtagttgtgacccattacaag
aagaagggattgagatacatcaagcacaagccagcattgttggccgacgaaattacgttg
aacaattaccaacaagtgggcatcaattggctcaatttattataccaaaacaggttgtct
tgtatattggcagatgagatgggtttgggtaaaacatgccaggttattgcctttatggct
catttaaagcagaccgaagaaaagaagggtcctcatttggttgtcgttccagcttctacg
cttgagaactggttaagagaattcaataagttctgtcccgacttgaaggtacaagcttac
tatggtacagtcaaggaacgtgaagatttaagatacgaacttagagaaatcgactttgac
gtcttggtgactacatatacgttagcagccggttctccgttggatttcaaattcttgagg
agtcagaatttcaacatcattgtatacgatgaaggtcacttcttgaagaattcaggaact
gaaaggtacaacagattgatgaaattgcaagccaagttcagattgttattgactggtaca
cccttgcagaataacttgaaggagttggtctccttgttgtctttcatgttgccaaaattg
ttcaacgaaaagaaagaagacttacaaggtttgttcaaccagaagatgggtaaagttact
tcgtcatcaaagtcagacaactacaatcccttactctcgattcaagccatcagaaaggca
aagacaatgatgactccgtttgtcttaagacgtagaaaggaccaggttcttcaacacttg
ccagccaagtgccatgagatagtgaagtgtgacttgtccaaggaccaaagaagtatttac
gatgaactttacaataaagctaagtccaccagatcagaaagggagagaagaaaacttctt
agttccaaggagcaggtagaattaaacaagaagcaaccgattgagtcttcttccaacgta
ttgatggcattaagaaaggcttctttgcatcctcttttgttcagaatccagtatactgac
gagaaactagccaaaatggccaaggctatcatgaatgagccagaatacgtggaagccaat
caaacatatatcttcgaggatatgcaagtcatgtcagactatgaactcaacaatctttgt
gctaaattccctaagactatgtccccctataaattgaacgaagacgcctttctcaatagt
ggaaaagtattggaattgcaaaagacattgaagctaatcatcgagggccggcaagaaaag
gtcttaattttctctttattcacccaggtgttggacatattggaaagagtcttgactcag
ttcaaatacaagttcgttagattggacggagccacttctgtcgaatcaagacaggatatt
attgacgaattctatgacgatgaaacaattccaattttccttttatctaccaaggccggt
ggatttgggattaacttgatcgccgccaacaatgtcattattttcgatcagtcattcaac
cctcacgatgacaagcaagccgaggatcgttgccatagagtgggccaaaagaaggaggtc
acagtgtacaagctcattgtcaacgatacagtcgaggaaaatatgttgaagttggccgag
aacaagttgcagcttgaccaaaccattagtgccgaaggggccgaagaggctaagttcgag
gagaaggcagcctctttgtttgaaaagttgctctttgaatag

DBGET integrated database retrieval system