KEGG   Scheffersomyces stipitis: PICST_57741
Entry
PICST_57741       CDS       T01023                                 

Definition
(RefSeq) predicted protein
Organism
pic  Scheffersomyces stipitis
SSDB
Motif
Pfam: OPT Poxvirus
Other DBs
NCBI-GeneID: 4837893
NCBI-ProteinID: XP_001383317
JGI: 57741
UniProt: A3LQX3
Position
3
AA seq 907 aa
MSKEKVELENIISIRSTRLDVADHEIDLHAVESAALSLNHVGQTFTSSQKYFILKRLNYE
GLEDLNDIPPGASFMIEKTEKLTEQESLEIIKEAIIEHSDDVNIPSRDYELWENLVEQAP
NSLDGQTGIKEKLNYTIEDEKGSVDLADNESGYNDYYQIVNWNLQIRLEAALVAYHSPYP
EVRAVADCYDDPTLPVETLRVYILGIIWTAIGAFINQFFAERQPSITLSAAVVQLLLYPS
GVLIATILPAWKFKIWKCTIDLNPGPWNHKEQMLTTIFYSVSAGTSYVSYNIHVQKMERF
YNNQWADFGYQTLLILSTNFLGFGFAGIMRKFAIYPIRSIWPTTLPTLALNKALMQKERK
ENINGWTISRYYFFFAAFLFSFIYNWIPTYLFNALSTFNWMTWIAPNNFNLVMITGSVKG
LGLNPIPTFDWNILNWNYALVFPFYSQANQYIGSIIGFFTIIAIYWTNNNWSKYIPINTS
SLFSQIGTRYDVKAIVNERSLFDQQKYEAVGPPYYSAANLVVYGAFFAIYPFAIVYEVFM
NYKPMWKALKGLGTALKNFRKSTYEGFDDPHTKMMTRYKEVPDWAFVFVLVISIVLAILC
VKLYPAETPVWGIFFTVGINFCFLIPLTAIFSTTGFQFGLNVLVELIVGYALPGNGLALN
FLKAFGYNINGQAQNYISDQKMGHYAKIPPRAMFRCQMLSVFITSFIGLGVMNFTMSSVN
NYCDPENRQKFTCPNATVFYNASILWGVIGPKKVFEGIYPVMQYCFLIGFLLAFPCIAFK
KYGPKKLTKYFQPTLIIGGMLIYAPYNLTYYTGGLYLSIASMWYLKKYYTTWWEKYNFVF
SGAMDAGIAFSAIIIFFAVQYVDKSIYWWGNNVPYLGIEGGEGQQTLLTAALDAPDGYFG
LRNGTYP
NT seq 2724 nt   +upstreamnt  +downstreamnt
atgtcaaaagaaaaggtagagttggaaaacatcatcagtatccgttcaacaagattggac
gtggctgatcatgaaatcgacttgcacgctgttgaatcagctgccttgtcactcaaccat
gttggccaaacgttcacatcgagtcagaagtactttatcttgaaaagattgaactacgag
ggtttagaagatcttaatgacatccctccaggagcttcattcatgattgaaaaaactgaa
aaattaacagaacaagaatctcttgagataatcaaggaagcaatcattgaacacagtgat
gatgtcaacattccgtcccgtgattacgaattatgggaaaacttggttgaacaggcccca
aattctttagatgggcaaactggtatcaaggaaaaattgaactataccatcgaagacgaa
aagggtctggttgatcttgctgacaatgaaagcggctacaatgattactatcaaatcgtt
aactggaacttgcaaatcagacttgaagctgcacttgttgcttaccactctccttacccc
gaagtgagagccgttgccgattgttatgatgatcctaccttgccagttgaaacattaaga
gtttacatcttgggtataatttggactgctatcggtgctttcattaaccagtttttcgct
gaaagacaaccttcaattacgttgagtgccgctgttgtgcagttgttgctttacccttct
ggtgtcttgattgccacaattttacctgcttggaaattcaaaatctggaaatgcaccatc
gatttgaatcctggtccatggaaccacaaggagcaaatgttaacaacaatcttctattca
gtttctgctggtacaagttatgtctcatataacatccatgttcaaaagatggaaaggttt
tacaacaaccaatgggccgacttcggttaccaaactctcttgatcttgtcgactaacttc
ttagggtttggttttgctggtatcatgaggaagtttgcaatttatccaatcagatctata
tggccaacaaccttgcctacattagccttgaataaggcattaatgcaaaaagaaagaaag
gagaatattaatggctggactatttctaggtactatttcttttttgctgcatttctcttt
tcctttatttataactggattccaacctatcttttcaatgccttgtctactttcaactgg
atgacttggattgctccaaacaattttaacttggtaatgatcactggaagtgtgaagggc
ttgggattgaacccaattccaacatttgattggaacattttaaattggaactatgcattg
gtttttcctttctactcgcaagcgaatcaatacattggtagcattattggcttcttcacg
attattgctatctattggactaacaacaactggtccaaatacattcctattaacacctct
tctcttttcagtcagattggtaccagatatgatgttaaagcaattgttaacgagagaagt
ttatttgatcaacagaaatatgaagctgttggaccaccatactactctgcagctaacttg
gttgtctatggtgctttctttgccatttacccatttgccattgtttacgaagttttcatg
aactacaaacctatgtggaaagcattgaaaggattgggtactgctcttaagaacttcaga
aaatccacatatgaaggttttgacgatccacatactaagatgatgactcgttataaggaa
gttccagactgggcatttgtatttgtattggtgatttctattgtgttggccattttgtgt
gttaagctttatccagctgagactccagtttggggtattttcttcaccgttggcatcaac
ttctgtttcttaattccattaactgctattttctctactactggtttccaatttggtctt
aatgtcttggtcgaattgattgttggttatgctcttccaggtaacggtttggctcttaac
ttcttgaaagcttttggttataacattaatggccaagctcagaattacatttccgaccaa
aagatgggtcactatgcgaagatacctccaagagccatgttcagatgtcaaatgctttcc
gtcttcattacttcgttcatcggtttgggtgttatgaactttaccatgtccagcgtcaac
aactactgtgaccccgagaacagacagaagttcacttgtcctaacgcaactgttttctac
aacgcttctattctttggggtgtgattggacctaaaaaggtgtttgaaggtatctaccct
gtcatgcaatattgtttcttgattggcttccttttggctttcccatgtatagcctttaag
aagtatggtccaaaaaaattaacgaagtacttccagccaacattgattattgggggaatg
ttaatttatgctccttacaatttgacttattacactggtggcctctacctttctattgcc
tccatgtggtaccttaagaagtattacactacttggtgggaaaagtacaattttgttttc
tctggtgccatggatgccggtattgctttcagtgcaattattattttctttgctgtacag
tatgttgataagagcatttactggtggggtaacaatgtcccataccttggtatcgaaggt
ggtgaaggtcaacaaactcttcttactgctgcccttgatgcccctgatggatactttggt
ctcagaaatggaacctatccatag

DBGET integrated database retrieval system