KEGG   Scheffersomyces stipitis: PICST_57812Help
Entry
PICST_57812       CDS       T01023                                 

Definition
(RefSeq) histone deacetylase
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pic  Scheffersomyces stipitis
Pathway
pic04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pic00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    PICST_57812
Enzymes [BR:pic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PICST_57812
Chromosome and associated proteins [BR:pic03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PICST_57812
   HDAC complexes
    Sin3A-HDAC complex
     PICST_57812
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PICST_57812
  Chromatin remodeling factors
   NuRD complex
    PICST_57812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 4837837
NCBI-ProteinID: XP_001383681
JGI: 57812
UniProt: A3LR07
Position
3
AA seq 488 aa AA seqDB search
MYVRLPFDELKVDESKKTRVAYFYDRDVGNYFYGTGHCMKPHRIRMTHSLIMNYELYKKM
EIYRARPATNTELTQFHTDEYIDFIDRVTPDNLHMFEREQIIFNVGDDCPVFDGLGEFCK
ISCGGSMEGAARINNGSCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRVHPRVL
YIDTDVHHGDGVEEAFYTNDRVMTCSFHKFGEFFPGTGNLNDVGIGKGKYHAVNIPLRDG
IDDASYKSIFEPIISKIIEWYQPSAIVLQCGGDSLSGDRLGPFNLSMRGHANCVSYVKSF
GIPMMVVGGGGYTIRNVARTWAFETGICNDVILDKELPYNGYYEYYAPLYELDVRSSNMT
NANSPEYLDRILMNVISNLDHTKHAPSVQMNEVPRDLEDFGDIEEDEMDAMDTKGGSLYS
RDKLVQPGNEFYDEDDKNRNERNIDIDVDVRVNGNGTSSNGTGNGVHKNVLTDAELNEID
HLNQEVAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttcgtttaccgtttgacgagcttaaagtggacgagtccaaaaagaccagagta
gcctacttctacgacagagacgtagggaactacttctatggaactggccattgtatgaag
ccccacagaatacgtatgacccattcgttgatcatgaactacgagttgtacaagaagatg
gaaatctacagagcaagaccggcaaccaataccgagttgacgcagttccacacagatgaa
tacatagacttcatagacagggtaacacctgacaacttgcacatgtttgaaagagaacag
attatcttcaatgttggtgatgactgtcctgttttcgatggtttgggagagttctgtaag
atctcgtgcggtggatcgatggaaggagctgctcgaataaataatgggtcatgtgacgta
gcaattaactacgctggaggtttgcaccatgccaaaaagtctgaagcttcgggtttttgc
tatttgaacgacattgttttgggcataatcgagttgttacgtgttcacccaagagtgctc
tacatcgacactgatgttcatcacggtgacggagttgaagaggctttctacacaaatgac
cgagtcatgacttgttcgtttcataagtttggggaattttttcctggaacaggtaactta
aacgatgttggtattggaaagggtaagtatcacgctgtgaatattcctctaagagacggg
atcgacgatgcctcatacaaatccattttcgaacctataatcagtaaaatcatcgaatgg
taccagccttcagctattgtgttacaatgtgggggagactccttgtcaggagaccgtttg
ggtccattcaacttatctatgagaggccatgccaattgtgtaagctatgtgaagtcattt
ggtatacccatgatggttgttggtgggggagggtacactatacgaaatgtcgcacgaacc
tgggcatttgagacaggaatctgtaacgacgttatcctcgacaaggaattgccttacaat
ggctactacgagtactatgctccgttgtacgagttggacgtgcgatcgtcgaacatgaca
aacgccaactcgcccgagtacttggaccggattttgatgaatgtgatatccaacctcgac
cacaccaaacatgctccttcggtccagatgaacgaagttccacgtgacttggaggacttc
ggtgatatcgaagaagatgagatggatgccatggatacgaagggtggctcgctctattcg
cgagataagctagttcagccaggcaacgagttctacgacgaagacgataagaaccgcaat
gaacgcaacatagacatagacgtcgatgtgagagtcaatggtaatggcactagtagcaac
ggcactggcaacggagtgcacaagaatgtgttgaccgacgccgagctaaacgaaattgac
catctcaaccaagaggtcgctgcgtag

DBGET integrated database retrieval system