KEGG   Scheffersomyces stipitis: PICST_63000Help
Entry
PICST_63000       CDS       T01023                                 

Gene name
CYP559
Definition
(RefSeq) cytochrome P450
  KO
K00493  unspecific monooxygenase [EC:1.14.14.1]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00071  Fatty acid degradation
pic00380  Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    PICST_63000 (CYP559)
  Amino acid metabolism
   00380 Tryptophan metabolism
    PICST_63000 (CYP559)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     PICST_63000 (CYP559)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 4840510
NCBI-ProteinID: XP_001386211
JGI: 63000
UniProt: A3LZM9
Position
7
AA seq 531 aa AA seqDB search
ILGVFLAYHLILYPFFLSPLRDVPGPYLHRISSLSSLNKQRKGRWTMTVYELHKRYGDVV
VLSPTEVSVNGNSKYVHDIYIKNFPKAKFYENFRNHGFKDNMFASLENDRHIAYKKLIMN
LYSKSAIFNKKNGTHSIIVQKVGQLVDDIRQSSSGKTQNLGIEVYTLFASLAMDVVSAFE
LGMSNGTDLLLHPEKRHIIISHRQVASMVFWTTLMPRFWNWAASSTILKASYDITKWQLG
LYAQAEENVPDVKEDENKSTLETLKQKGLKGEYAYSFLTDNIFAGHETTAIQLAYMCYEL
SRPKNLHLQESLRKELIREFGHPKSEKDIIDDMSKVDVLPYLNSVLDENSRVHASIPGSE
PRLVDSPYKVEVGEGKVVELPKGTGISCVVYALHRQSDVFAEPDQFIPERWLQYENEPDE
VFRQRIKRMQRYMMPFGKGIRMCLGMNLALIEMKMAIANLYWHYNSKICSDWCEITEYTE
DSKKLNPILMGETRKGENRTDEEKMTMYDSYTTRPLNDECWLEWYDNQFEN
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atacttggagtttttcttgcttaccatctcattctttatccgttcttcttatcaccttta
agagatgttccaggtccatatttacatcgaatctctagtctctcctctttgaacaaacag
aggaagggacggtggactatgacggtttacgagttgcacaagaggtatggagacgttgtg
gtattatctccaacagaggtttcagtaaatggaaattccaaatatgttcatgatatatat
atcaagaacttccccaaagcaaagttctacgaaaattttcgcaatcacggcttcaaggac
aacatgttcgcgagtttggaaaatgacagacacattgcctacaagaaactaattatgaac
ttgtacagcaaaagtgccatcttcaataagaagaatggaacacatagtatcattgttcaa
aaagtagggcaattggtcgatgacatacgccaaagttcgtctggaaagacccagaattta
ggaatcgaggtttacaccttatttgcatcgctagccatggacgttgtttctgctttcgag
ttgggaatgagcaatggcacagatttgttattacatcccgagaaacgtcacattattatc
agtcacagacaggttgcaagcatggtgttctggacaactttaatgcctcggttctggaac
tgggccgcgagctctaccatcttgaaggctctgtatgacattactaaatggcaacttgga
ttatatgctcaggcagaagagaatgttcccgacgtaaaagaagatgaaaataagtcgacg
cttgaaacattgaaacagaagggtctcaagggggaatatgcttattccttcttgactgac
aacatatttgctggccacgaaaccactgccatccagcttgcgtacatgtgctacgagctc
tcgcgtccgaagaatctccacttgcaagaatctttgagaaaggaattgattagagaattt
ggtcatcccaagtctgaaaaggatatcattgatgatatgagcaaagtcgatgtccttccg
tatttaaattctgttctagatgagaattctagagtacatgcttcaattcctggctctgag
ccacgtttagtagattctccctacaaagtcgaagttggcgagggtaaagtggtagaatta
cccaaaggtactggtatttcttgtgtggtttatgcattacatagacaatctgatgtattt
gcagaaccagaccaatttatccctgaaagatggttacaatatgaaaacgagcctgacgaa
gttttcagacaaaggatcaagcgaatgcaacgttacatgatgccattcggaaaaggaatt
agaatgtgtttgggaatgaacctcgcattgattgagatgaagatggccattgctaacctt
tactggcactacaattccaagatatgtagtgactggtgtgaaatcaccgaatacacagaa
gacagtaaaaagctcaacccaattttaatgggtgaaacaagaaaaggagaaaaccgcact
gatgaagagaaaatgactatgtatgatagctacaccacaagaccccttaacgatgagtgc
tggttggaatggtacgacaatcaatttgagaactag

DBGET integrated database retrieval system