KEGG   Scheffersomyces stipitis: PICST_63551
Entry
PICST_63551       CDS       T01023                                 

Definition
(RefSeq) transcriptional repressor TUP1
  KO
K06666  general transcriptional corepressor TUP1
Organism
pic  Scheffersomyces stipitis
Pathway
pic04011  MAPK signaling pathway - yeast
pic04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:pic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    PICST_63551
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    PICST_63551
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pic03021]
    PICST_63551
Transcription machinery [BR:pic03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     PICST_63551
SSDB
Motif
Pfam: WD40 Tup_N ANAPC4_WD40 WD40_like Ge1_WD40 Nup160 IKI3 Siah-Interact_N
Other DBs
NCBI-GeneID: 4840582
NCBI-ProteinID: XP_001386024
JGI: 63551
UniProt: A3LYL3
Position
7
AA seq 522 aa
QRQQHQQRLNELLDAVKQEFDYALTEASSFKQVKEDYDIKYNQQTAEMQQIRQTVYELEM
AHRKIKEAYEEEILRLKTELESRDRQAQIQQQQQQQPSQPAAIQTPSQQALPPPIKQSPP
KQEIKPTSTALTVIDKSQYIVNPTQKALHVKEIPPFLSDLDVSKANPDFKKQKLDYYVLY
NPAFARDLDVELIHSLDHSSVVCCVRFSKDGKFIATGCNKTTQVFNVETGELVAKLIDDN
NSSDAASAVAAANGDLYIRSVCFSPDGKLLATGAEDKLIRIWDLNTKRIIKILRGHEQDI
YSLDFFPDGDRLVSGSGDRTVRIWDLRSSQCSLTLSIEDGVTTVAVSPDGQLIAAGSLDR
TVRVWDSTTGFLVERLDSGNENGNGNGHEDSVYSVAFTINGKQIASGSLDRTVKLWNLEG
KQDPQGNNSPGKKSSCEVTYIGHKDFVLSVCSTPKNEYILSGSKDRGVIFWDQLSGNPLL
MLQGHRNSVISVAVSLNSQGTEGIFATGSGDCKARLWKWTRK
NT seq 1569 nt   +upstreamnt  +downstreamnt
cagagacagcagcatcagcaaagattgaacgagttgttggacgcagtcaagcaggagttt
gactatgcattgacagaagcatcgtcgttcaaacaggtcaaagaggactatgacattaaa
tacaatcagcaaactgctgagatgcaacaaataagacaaaccgtttacgagttggaaatg
gcccatagaaaaattaaggaggcctacgaggaagagatcttgcgcttgaaaacggagttg
gagtcccgggacagacaggcccagatccaacaacagcaacagcaacagcctctgcaacca
gcagctattcaaaccccatcgcagcaggcattgcctccacctatcaaacagtctcccccc
aaacaggaaatcaagcctacctcaactgcattgactgtcatcgacaaatcgcagtacatt
gttaaccccacccaaaaggctctacacgtcaaggagattcccccattcttgtcagacttg
gatgtttccaaagcgaacccagacttcaagaaacagaagttagactattatgtcttgtac
aacccggccttcgctcgtgatttggatgtcgagttgattcactcgttggaccactcttcg
gtagtttgttgtgtgcgtttctccaaggacggtaagttcattgctaccggttgcaataag
actacacaagtgttcaacgtcgaaacgggagaattggtggccaagttgatcgacgacaac
aactcatctgacgctgcttctgccgttgccgccgctaatggtgacttgtatatcagatcc
gtttgtttctctccggatgggaagttattggcaaccggcgctgaagacaagttgatcaga
atctgggacttgaacaccaagagaattatcaagatcttgcgaggtcacgaacaggatata
tattcgttggacttcttccctgatggagacagattggtctctggttctggagacagaacg
gtgagaatctgggacttgagatcgtcacagtgctcgttaactctttccattgaagatgga
gtgaccacggtcgctgtttccccagatggccaattgatcgcagctggttctcttgacaga
acagtcagagtctgggattctactactggtttccttgttgaaagattagattccggaaac
gaaaacggcaatggaaatggccacgaagactctgtctactctgttgctttcacaattaac
ggcaagcaaattgcttctggttctttggacagaaccgttaagttgtggaacttggaagga
aagcaagacccacaagggaacaacagcccaggtaagaagtccagctgcgaagtgacctac
attggacacaaggactttgttttatctgtctgctctacgccaaaaaatgaatacatactt
tctggttccaaggaccgtggtgttattttctgggatcaactttctggtaatccattgttg
atgcttcaaggacaccgaaactctgtcatatcggttgccgtttccttgaactcccaaggc
actgaaggcatttttgctaccggtagtggagactgcaaggcaagattatggaaatggacc
agaaaataa

DBGET integrated database retrieval system