KEGG   Scheffersomyces stipitis: PICST_66436Help
Entry
PICST_66436       CDS       T01023                                 

Gene name
NIP1
Definition
(RefSeq) Protein required for nuclear import with some similarity to Nsr1p, another protein involved in nuclear transport
  KO
K03252  translation initiation factor 3 subunit C
Organism
pic  Scheffersomyces stipitis
Pathway
pic03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pic00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    PICST_66436 (NIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pic03012]
    PICST_66436 (NIP1)
Translation factors [BR:pic03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    PICST_66436 (NIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 4851313
NCBI-ProteinID: XP_001387924
JGI: 66436
UniProt: A3GGB4
Position
1
AA seq 839 aa AA seqDB search
MSRFFVAGYNSDSSSEEEDLLSSDEELLSSSSEGEQETSDDDSLDFDDQSDSDSSDSDSD
GRPSGPAYFLKKDFMKGGAGGDSDSDSEDEGRRVVKSAKDKLLDDMNESIEAINVARRSD
TWTTVVSEFDKLGRLLVRAGQQSVSTPNAYIRCLADLEDYITATSENEKTEKSLNAAEAR
AFNMAKQRVRKQIKEYQAQYDLYRENPELFEREESVDIAAPSRSDVPVEDTTGRVLSPVF
TILKQIAETRGKKNIDKYEQIKTLEDLLNDNLAKGSVFELISIYQMLLSIRFDASANQNF
MPIEQWKNNEADLTSLIGLLESNKDTYQLSELGSTTDDIDIEPVANESGVKAIFGSITSL
IDRLDDEFTRSLQNTDPHSIEYVQRLKDETTIYQLIVRGQSYIESITPAEVQQSVEQLSR
VVLRRLEHIYYKPDQLIKANEAEAWKGISHESVIVSKDSTPAELIEGLSSFLTKHKNPVY
AKHALLFSVYYYAVNNNYNRAKELFLDSQIFNKIHHADSSLQVQYNRAIVQLGLSAFRNG
AVEESHKVLNEIVNSQRSKELLGQGFNSKYPNQATTVEKAKLLPFHQHINLELLECVYST
CSLLIEIPALAAATNSKDSRRKATTKSFKSKLEFHDRQFFTGPPESIKDHIVHASIALSK
GDWAKAYQLLSSIKIWKLFPDNDDLLAMMKNQLQVEGLRTYIFSYKSIFSKLSLGKLSQI
FELEADKVESIVQKMIETNEIGGTLDESKAFIQFASTEPQRSRLQELAIVMNEKVGLLTE
KNEKTSSNGYGKKQPQQQQQQQQQQQQQQQQQKDLLQEDNSRFRYANVNTNNDEFQTTA
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtttctttgttgccggctacaactcggactcgtcgtctgaggaagaggacttg
ttgagttctgatgaagaattgctttcttcctcctctgaaggagaacaggaaacgtcagac
gatgacagcttagatttcgatgaccagtctgattctgactcaagtgactctgactccgat
ggccgtccaagtggtccagcatatttcttgaagaaggacttcatgaaaggtggtgctggc
ggagactctgactctgactctgaggatgaaggcagaagagtagtgaagtctgccaaggac
aagttgcttgacgacatgaacgaatccattgaagccattaacgtagccagaagatccgac
acttggaccaccgttgtatcggaatttgacaagttgggacgtctcttggttagagctggt
cagcaaagcgtgtctacgcctaatgcctacatcagatgtttggccgatttggaagactac
atcactgctactagtgaaaacgagaaaaccgaaaagtctttaaacgcagccgaagccaga
gcatttaacatggctaaacagagagtcagaaagcaaatcaaagagtaccaggcccaatat
gacctctacagagagaacccagaattgtttgaaagggaagaatccgtagacatcgctgct
ccttccagatctgatgttccagtagaagatactacgggcagagtcttgagtcctgtgttc
accatcttgaaacagatcgctgagactcgtggtaagaagaacatcgacaagtacgaacag
atcaaaaccttggaagacttgttgaacgacaatttggcaaagggctctgttttcgagttg
atttccatctatcagatgttgttgtcgatccgtttcgacgcttcggccaaccagaacttc
atgcctattgaacaatggaagaacaacgaggcagacctcacctctttgatcggacttttg
gaatccaacaaggacacctaccagttgtctgagcttggttctactactgatgatatcgac
atcgaacctgtagccaatgaatctggtgtcaaggctatctttggctccataacttcgttg
atcgacagattggacgatgaattcaccagatccttgcagaacaccgatcctcactcgatt
gagtacgtgcaaagattaaaggatgaaaccaccatctaccagttgatcgtgaggggccag
tcttatattgagtctataacgccagctgaagtccagcagtcggttgagcagttgtcgaga
gtcgttctccgtagattggaacatatctactacaagcctgaccagttgatcaaagctaac
gaggctgaagcctggaagggtatttctcacgagtctgtcattgtatccaaggactccact
cctgctgagttgattgaaggattgtcgtcgttcttaaccaagcacaagaatccagtctac
gccaaacacgctttgttgttctcggtctactactacgccgtcaacaacaactacaacaga
gccaaggagttgttcttggactcgcaaatcttcaacaaaatccaccatgctgactccagc
ttgcaagtccagtacaacagagccattgttcagttgggtttgagtgcattcagaaacgga
gctgtcgaagaatctcacaaggtattgaacgaaatcgtcaactcgcaaagatcaaaggaa
ttgttgggccaagggttcaactctaaatatcccaaccaagctacaaccgtggaaaaggct
aagttgttgcctttccaccaacacataaatttggaattgcttgagtgtgtttacctgacc
tgctcgttattgattgaaattccagccttggctgcagctacaaactccaaggactccaga
cgtaaggcaaccaccaagtcattcaagagtaagttagaattccacgacagacagttcttc
actggtcctccagagagtatcaaagatcacatagtgcatgcctccatagctttactgaag
ggtgattgggctaaggcttaccagttgttgtcgtctatcaagatctggaagttgttccct
gataacgatgacttgttggccatgatgaagaaccagttacaagtcgaaggtttaagaaca
tacattttctcctacaagtcgattttctctaagttatctttaggcaagttgtcgcagatc
ttcgagcttgaagctgacaaagttgagtccattgttcaaaagatgatagagacaaatgag
attggcggaacattagacgaatccaaggcatttatccaattcgccagtaccgagccacaa
agatccagattgcaagagttagctattgttatgaacgaaaaggttggtttgttgaccgaa
aagaatgaaaagacttcgtccaacggttacggtaagaagcagcctcaacaacagcaacaa
cagcaacaacagcaacagcaacagcagcaacagcagaaggatttgctccaagaggacaac
agcagattcagatacgccaacgttaacactaacaacgatgaattccaaactactgcctaa

DBGET integrated database retrieval system