KEGG   Scheffersomyces stipitis: PICST_66961Help
Entry
PICST_66961       CDS       T01023                                 

Gene name
LSC2
Definition
(RefSeq) succinate--CoA ligase (GDP-forming) beta chain (LSC2)
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00020  Citrate cycle (TCA cycle)
pic00640  Propanoate metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01200  Carbon metabolism
Module
pic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PICST_66961 (LSC2)
   00640 Propanoate metabolism
    PICST_66961 (LSC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pic04147]
    PICST_66961 (LSC2)
Enzymes [BR:pic01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     PICST_66961 (LSC2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PICST_66961 (LSC2)
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PICST_66961 (LSC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A VID27_N
Motif
Other DBs
NCBI-GeneID: 4837616
NCBI-ProteinID: XP_001382488
JGI: 66961
UniProt: A3LP98
Position
2
AA seq 414 aa AA seqDB search
MLSRTIARASRAVAQQKRFLSLHEYRSAALLEQYGVGVPKGYAATTAEGAFDAAKKLGTT
ELVIKAQALTGGRGKGHFDSGLQGGVKLISSPEEAKDLAAQMLGHKLITKQTGAAGKEVT
AVYIVERRDALTEAYVAILNDRAAQTPIIVASSQGGMDIEGVAAETPEAIHTFKVDLKEG
VTDKLATEVASVLGYTDAAIPEAAKAVQNLYKVFEEKDCTQVEINPLSETPDHKVLAMDA
KLGFDDNASFRQEEVFNWRDPTQEDPEEVEASKYGLNFIKLDGNIANIVNGAGLAMATMD
IIKLYGGKPANFLDCGGTATPATIEKAFELILSDKKVNGIFVNIFGGIVRCDYVAEGLIA
ATKNFNLDIPVVVRLQGTNMQQAKELIDNSGLKLFAFEDLDPAAEKIVELAPAN
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctagaaccattgcccgtgcctccagagctgttgctcaacagaaaagattcttg
tctttgcacgaataccgttccgctgccttgcttgagcaatacggcgtcggtgttcctaaa
ggttacgccgctaccacggctgaaggcgcctttgacgctgctaagaagctcggaaccact
gagttggtcatcaaggcccaagccttgaccggtggccgtggtaagggtcacttcgactct
ggtttacaaggaggtgtcaaattgatttcgtctccagaagaagccaaggacttggctgct
cagatgttgggccacaagttgatcacaaagcagaccggagctgccggaaaagaagtcact
gccgtatacattgtagaaagaagagatgccttgactgaagcttacgtagccatcttgaac
gacagagccgcccagactccaatcattgtcgcttcttcccagggtggtatggacatcgaa
ggtgttgctgccgagaccccagaagccatccacactttcaaggttgacttgaaggaaggt
gtcactgacaaattagctacagaagtagcttccgtattgggctacaccgacgctgccatc
ccagaagcagccaaggctgtccagaacttgtacaaggtgtttgaagaaaaggactgcacc
caagttgaaatcaaccctttgtctgaaactccagaccacaaggtattggccatggacgcc
aagttgggctttgatgacaatgcttcgttccgtcaagaagaagtattcaactggagagac
ccaacccaggaagaccctgaagaagtcgaagcttccaagtacggcttgaacttcatcaag
ttggacggtaacatcgccaacatcgtcaacggtgccggtttggccatggccactatggac
atcatcaagttgtacggaggtaagcctgccaacttcttggactgtggtggtactgccacc
cctgccactatcgagaaggctttcgaattgatcttgtctgacaagaaggtcaacggtatc
tttgtcaacatcttcggtggtatcgtcagatgtgactacgttgccgaaggtttgattgct
gccaccaagaacttcaacttggacattccagttgtcgtcagattacagggtaccaacatg
caacaggccaaggagttgattgataactcgggcttgaagttgtttgcctttgaagacttg
gaccctgccgccgaaaagatcgtcgaattggctccagccaactag

DBGET integrated database retrieval system