KEGG   Scheffersomyces stipitis: PICST_67737Help
Entry
PICST_67737       CDS       T01023                                 

Gene name
VPH3
Definition
(RefSeq) vacuolar ATPase V0 domain subunit a
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
pic  Scheffersomyces stipitis
Pathway
pic00190  Oxidative phosphorylation
pic01100  Metabolic pathways
pic04145  Phagosome
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PICST_67737 (VPH3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    PICST_67737 (VPH3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pic04147]
    PICST_67737 (VPH3)
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PICST_67737 (VPH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 4839578
NCBI-ProteinID: XP_001385041
JGI: 67737
UniProt: A3LUS8
Position
5
AA seq 947 aa AA seqDB search
MQPIQLSDDSSSVAPEAIFRSAPMTLVQFYVTIELARDMVYTLGNLGDVHFRDLNSKLTP
FQRTFVSELRNIDTMESQLAFLNSIMIKYETIKSDVFVNLKADMDPLPTTSEMDDMKQKI
TTFYDRIKHLDNSYNVLNEQKMAVVENRHVLNAVTDFHSSSLIGGYNESRISLSLSDGAD
DDNVALLNNRNNSMELGSETINLEESGFDAISGTIVREKVPLLRNILWRTMRGNLYFHDV
PIDNEKLFDYNATQEELVNKNVFIVYIHGDLLRTRVRRIIQSLDGNIFDNVNGGASARAA
TSSELNAKITDLNNIVMTTKNHLIAELLIFQEAYPDYCFIVQRDKLIYQTLNKFDEDSTR
RCLVGEGWIPTSDFGLIRQTLRHLVREKTRRGDGESDSQESVPLTQQGSSPNPVSQTYTN
LGSGNSSLFAIDDATDDFSELEDEEYGSLIAIVNELSTNRTPPTYHNVNKFTSAFQSIID
AYGIATYQEVNPGLATIVTFPFMFAIMFGDIGHGLIVLLISLYLIKNEVHFGAMRNKDEI
FEMAFNGRYIILLMGLFSMYTGFLYNDIFSKTITLFKSGWVWNFPKDYDFTKDGPVTLVA
EKAARTYPIGLDWAWHGAENNLLFTNSYKMKLSVLMGFVHMNYSLFFSLVNYRYFKSRVD
IIGNFIPGFLFMQSIFGYLSLTIVYKWSVDWLGKGKQPPGLLNMLINMFLAPGKVEEQLY
PGQKYIQVFLVLVALVCVPWILVYKPLTLKRQNDRAIQLGYKDLHSQANHSIQLHEEMEA
TQLEEDLNHDPDDDDFEISDDDFHFPNDIEPLHHNSTSHGEDGSDFNFGDIVIHQVIHTI
EFCLNCVSHTASYLRLWALSLAHAQLSTVLWTMTIQNAFYTTGNAGIAMVVALFGLWFIL
TVCILVLMEGTSAMLHSLRLHWVEAMSKFFEGEGYAYEPFTFKSIDL
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctattcagctatctgatgatctgtcttctgttgctccggaggcgattttccgg
tcagcccctatgacgttagtgcagttctatgtgacaatagagttggctagagatatggtt
tatactttggggaatcttggcgatgtccatttccgagacttaaactccaagttgacacca
tttcagaggacatttgtgctggaattgcgtaacattgacaccatggaatcacagcttgca
ttcctcaattccattatgattaagtatgaaacgatcaagagtgatgtgtttgtcaatttg
aaggcggatatggacccgcttcctactacgtcagagatggacgacatgaaacagaaaatc
acaacgttttacgacagaataaagcacttggataactcgtacaacgtactaaatgaacag
aagatggcagtagtggaaaacagacatgtgctcaatgctgtaaccgacttccacagcagc
agtcttataggtggatataacgagtcgcgtatttctctctctctttctgatggtgcagat
gatgataatgtagcacttttgaataacagaaacaacagcatggaattgggttccgaaaca
atcaatcttgaagagtcaggtttcgatgccatttccgggacaattgtaagagaaaaagta
cctcttttgagaaacatcttatggagaaccatgagaggtaacttgtatttccatgacgtg
ccaatagataacgagaaattgtttgactataatgcaacccaggaggagttggtcaacaag
aacgtctttattgtgtatatacatggagatttgttgagaacacgagtgagaagaatcatc
cagtcccttgatgggaacatcttcgacaatgtcaacgggggagcatctgccagggcagct
acctcttctgaattaaatgcgaagatcacggatttgaacaatattgttatgaccaccaag
aaccatctcattgccgagttgttaatttttcaggaggcgtacccagactattgctttata
gtacaaagggacaagttaatctaccaaacactcaacaagttcgatgaagacagcactaga
aggtgcttggtaggagaaggttggattcccacctctgactttggacttattcgtcaaaca
ttgagacatctcgtacgagaaaagactcgtcgtggcgacggagaaagtgactctcaggaa
tcggttcctttaactcaacaagggtcatctccaaatcccgtgagccagacgtatactaat
cttggtagtggtaattcatcgttatttgccattgatgatgcaacagacgatttttcagag
ttggaagacgaagaatatggttctttgatcgctattgtcaatgaactttcgactaaccgt
accccgcctacctatcataatgtaaacaaattcacttccgctttccagctgattatagac
gcctatggtatagccacgtaccaagaagtgaatccaggattggccacgattgtaacattt
ccctttatgttcgccatcatgtttggtgatatcggacatggtttgatagtcttgctcatc
agtttgtaccttatcaaaaatgaggtgcactttggtgccatgaggaataaggatgaaatt
tttgaaatggctttcaatggtagatacatcatcttgcttatgggtcttttctccatgtac
actggatttttatacaatgatatcttctctaaaacaattaccttattcaaatctggctgg
gtatggaattttcctaaggattacgattttaccaaagacggtccggtgacattggttgct
gagaaggccgcacgcacatatcctataggtctcgattgggcctggcacggagctgaaaac
aacttgttgttcaccaattcatacaaaatgaaactttctgttttgatgggttttgtccat
atgaactactcgttgttttttagtttggtcaactatagatatttcaagtctagggtcgat
atcatcggtaacttcattcctggtttcttattcatgcagagtatatttggttatttgtct
ttgaccatcgtctacaaatggtcagtagactggttaggaaaaggtaagcaacctccaggt
ttacttaatatgttaatcaatatgtttttggctccaggtaaagttgaagaacaattgtac
ccaggtcagaagtatattcaggtattcttggttcttgtcgcattagtttgtgttccatgg
attttggtgtacaaacctttgacattaaaacgtcaaaatgatagagcaattcaattgggt
tacaaggacttacactcgcaagccaaccattctattcaactacacgaagaaatggaagcc
acgcaattagaagaagatttgaatcacgatcccgatgatgatgattttgagattctggac
gatgatttccatttcccaaatgatattgagcctttgcatcataattcgacctcccatggc
gaagacggaagcgatttcaattttggagatatagttattcatcaagtaattcacacaatt
gaattctgtttgaattgtgtcagtcatactgcttcctacttgagattgtgggctttatct
ttagctcatgcacaactttcaactgtgttatggacaatgactatccaaaacgcattttat
acaacaggcaatgcaggaatagcaatggttgttgcgctctttggtctttggtttatattg
acggtgtgtatcttagttttgatggaaggaacatcggctatgttgcattcgctcagatta
cattgggttgaggctatgtccaagttctttgagggcgaaggctatgcgtacgaacccttt
acattcaaatcaattgatttatag

DBGET integrated database retrieval system