KEGG   Scheffersomyces stipitis: PICST_68297Help
Entry
PICST_68297       CDS       T01023                                 

Gene name
KGD2
Definition
(RefSeq) 2-oxoglutarate dehydrogenase complex E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00020  Citrate cycle (TCA cycle)
pic00310  Lysine degradation
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01200  Carbon metabolism
Module
pic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PICST_68297 (KGD2)
  Amino acid metabolism
   00310 Lysine degradation
    PICST_68297 (KGD2)
Enzymes [BR:pic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PICST_68297 (KGD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N CCDC53 HlyD_D23
Motif
Other DBs
NCBI-GeneID: 4840523
NCBI-ProteinID: XP_001386275
JGI: 68297
UniProt: A3LYY4
Position
7
AA seq 438 aa AA seqDB search
MLSRSIKSSLKRAPVSRAVALSATKLSLRMSSGPVSRSIHTATTSGAGFSRISGLTFKRY
ASVTVKVPDMAESITEGTLSALNKNVGDYVNVDETIATVETDKIDVEVNSPVAGTITEFL
VAVDDTVEVGQDLAKIEEGEAPAGGAAPSEAPKEEAAPAAAPAAAPAAAPAAAPKAAPAA
PKAPAPAKKEEPKKEAPVASFTNFSRNEERVKMNRMRLRIAERLKESQNTAASLTTFNEV
DMTNLMEMRKLYKDEFLEKTGIKLGFMGAFAKASCLAAKDIPAVNASIENNDTLVFRDYT
DISVAVATPKGLVTPVVRNAESLSILGIEQEIASLGKKARDGKLTLEDMTGGTFTISNGG
VFGSLYGTPIINMPQTAVLGLHGTKQRPVTVNGQIVSRPMMYLALTYDHRVLDGREAVTF
LKTVKELIEDPRKMLLLE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctagatccatcaagtcgtctttgaaacgtgctccagtttccagagctgttgca
ctttctgccaccaagctctctctcagaatgtcttctggtcccgtttccagatcgatccac
actgctactacctctggtgctggtttctccagaatttctggtttgaccttcaagcgttat
gcttctgtcaccgtgaaagttccagacatggccgagtccattaccgaaggtacactttcc
gctctcaacaagaacgtcggagattacgtcaatgtagatgagaccatcgccactgtcgaa
acagacaagattgacgtcgaagtcaactcgcctgttgctggtaccatcaccgagtttctc
gttgctgttgatgacactgtagaagtgggtcaggatctcgctaagatcgaagaaggcgaa
gctccagctggcggagcagccccatctgaagctccaaaagaggaagctgcacctgctgct
gcccctgctgcagctccagccgcagctccagccgctgctccaaaggctgccccagctgct
ccaaaggcaccagctccagctaaaaaggaagaaccaaagaaggaagctccagtcgccagc
ttcaccaacttctccagaaacgaggaaagagtgaaaatgaacagaatgagattaagaatc
gcagaacgtcttaaggaatcgcagaataccgctgcctccttgaccactttcaacgaagtt
gacatgaccaacttgatggaaatgagaaagttgtacaaagacgagttcttggaaaagacc
ggcatcaagttgggtttcatgggtgctttcgctaaggcctcatgtttggctgctaaggat
attccagctgtaaacgcttccatcgaaaacaacgacaccttagtgttcagagactacacc
gacatctccgttgctgttgctactcctaaaggtttggttactcctgtagttagaaacgcc
gaatccttgtctattttgggcatcgaacaagaaatcgcttctttgggtaagaaggccaga
gacggtaagttaactttggaagacatgaccggtggaactttcaccatctccaacggtggt
gttttcggttccttgtatggtactcctatcattaacatgcctcagactgctgtcttaggt
ttgcacggtaccaagcaaagacctgttaccgtcaacggtcagatcgtgtcaagaccaatg
atgtacttggccttgacctacgatcacagagtattggacggccgtgaagctgtgacattc
ttgaagaccgtcaaggagttgatcgaagaccccagaaagatgttgttgttagagtag

DBGET integrated database retrieval system