KEGG   Scheffersomyces stipitis: PICST_69669Help
Entry
PICST_69669       CDS       T01023                                 

Gene name
TRP5
Definition
(RefSeq) tryptophan synthetase
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00260  Glycine, serine and threonine metabolism
pic00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01230  Biosynthesis of amino acids
Module
pic_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PICST_69669 (TRP5)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PICST_69669 (TRP5)
Enzymes [BR:pic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PICST_69669 (TRP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA PALP
Motif
Other DBs
NCBI-GeneID: 4851612
NCBI-ProteinID: XP_001387018
JGI: 69669
UniProt: A3GH63
Position
1
AA seq 700 aa AA seqDB search
MSALLKETFARCKKEGRNALVNFITAGYPTIEDTVPILKSMQDAGVDIIELGIPFSDPIA
DGPTIQAANNVALDNGITVPKCLDLVKQAREQGVTVPIILMGYYNPILKYGEIKLIEDSA
RVGANGFIVVDLPPEEAIKFRSSCARYGLSYVPLVAPATTDERLKVLGEIADSFIYVVSK
MGTTGASKSVSSGITELCARVRKFAGSTPIAVGFGVSTREHFLTVGESADGVVIGSRIVT
LIGESKPGERGVTAYKYVKSILGEGFSVNAPTSFSRAVVIDGTETKPVLEEDHKFNPKFG
EFGGQYVPEALHTCLAELEKGFESAVADPEFWKEFKDLYSYIGRPSSLHRAERLTEYAGG
AQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLEC
TVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTQTLRDATSEAFRFWVSNLESTHYVVGS
AIGPHPYPTLVRTFQSVIGQETKEQFKTLNGGKLPNAVVACVGGGSNSTGMFSPFEHDTE
VKMLGVEAGGDGLDTDRHSATLTAGIPGVFHGVKTYVLQDSDGQVHDTHSVSAGLDYPGV
GPELAFWKSTGRADFVAATDAQALIGFKLLSQLEGIIPALESSHAIYGGVELAKTMPKDQ
HIVINVSGRGDKDVQSVAEVLPKLGEQIGWDLRFEADPTK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttattgaaagaaacttttgctaggtgtaaaaaagagggacgaaatgctttg
gtcaacttcattactgctggttaccctactattgaggacacagttccaatcttgaagagc
atgcaagatgccggtgtagacatcattgaattgggtatcccattctccgacccaattgct
gatggtccaaccatccaagctgctaataatgtcgcgttggacaacggaatcaccgtccca
aagtgcttggacttggtcaagcaagcaagagaacaaggtgtcactgttccaatcatattg
atgggttactacaatccaatcttaaagtacggtgaaatcaagttgattgaggactctgca
agggtaggtgctaacggtttcattgtcgtcgacttgcctcctgaggaagccatcaagttc
agatcgtcttgtgcacgttatggattgtcttatgttcctttggttgcccctgccactact
gatgaaagattgaaggtcttgggagaaatcgcagattcctttatctacgtagtttctaag
atgggtaccactggtgcttccaaatctgtttcttccggtatcactgagttgtgtgctaga
gttagaaaatttgccggctctaccccaattgccgtaggtttcggtgtgtctacaagagag
catttcttaactgttggtgagagcgctgatggtgtggttattggttctagaatcgtgacc
ttaattggtgaatctaagccaggtgaaagaggtgtgaccgcttacaagtatgtcaaatcc
attttaggtgaaggcttttccgtcaatgcgccaacttctttctctcgggctgtagttata
gatggaactgaaactaagccagttcttgaagaggaccacaagttcaacccaaaatttggt
gaatttggtggtcaatatgttcctgaagcattgcacacttgtttggctgaattggagaaa
ggatttgaaagcgcagttgctgatcccgagttctggaaggaattcaaggacttgtactct
tacattggaagaccatcttctttgcatagggccgaaagattgactgaatatgccggaggc
gctcagatctggttgaagagagaagatttgaaccatactggttctcacaagatcaacaat
gccttggctcaagtgttaattgctaagagattaggtaagaagaagattattgctgagact
ggtgctggtcagcatggtgttgctactgctactgcatgtgctaagtttggattggaatgt
accgttttcatgggagccgaagatgtaagacgtcaagccttgaatgtgttcagaatgaga
atcttgggtgcaaaggttgttgctgtcactaatggtacccaaacattgagagatgcgact
tctgaagccttcagattctgggtatcaaacttagagtcaacgcactatgttgtcggttca
gcaattggaccacatccatacccaaccttggttagaaccttccaaagtgttattggtcaa
gaaaccaaagagcagtttaagactttaaacggcggtaagttaccaaacgccgttgttgct
tgtgtcggcggtggttcgaactccactggtatgttctctccttttgaacacgatactgaa
gtcaaaatgttaggtgtcgaagctggtggtgacggcttagacactgatcgccattctgca
actttgacggcaggtattccaggtgtgttccatggtgtcaaaacttacgttcttcaggac
agtgatggacaggttcatgacactcattcagtttctgcgggtttagactatcctggcgta
ggtccagaattggcattttggaagagcactggtcgtgctgacttcgttgctgctacagat
gctcaggcattgatcggatttaaattattgtcccaattggagggtataattccagctttg
gagtcttctcacgctatttatggtggtgttgagttggctaagactatgccaaaggatcaa
cacattgttatcaatgtttcaggacgtggtgacaaggatgtgcaaagtgttgccgaagtt
ttaccgaagttaggcgagcagattggctgggacttgagattcgaagccgatcctacgaag
taa

DBGET integrated database retrieval system