KEGG   Scheffersomyces stipitis: PICST_69676Help
Entry
PICST_69676       CDS       T01023                                 

Gene name
BPL1
Definition
(RefSeq) biotin holocarboxylase synthetase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00780  Biotin metabolism
pic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PICST_69676 (BPL1)
Enzymes [BR:pic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     PICST_69676 (BPL1)
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     PICST_69676 (BPL1)
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     PICST_69676 (BPL1)
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     PICST_69676 (BPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_N BPL_LplA_LipB BPL_C Glyco_hydro_42M ThuA
Motif
Other DBs
NCBI-GeneID: 4852030
NCBI-ProteinID: XP_001387235
JGI: 69676
UniProt: A3GID1
Position
1
AA seq 675 aa AA seqDB search
MNVLVYSGQGTTTESVKHCLESLRLHLSPYYAVVTISEQSILNDPWIYKTSLLVIPGGAD
LPYCNVFNGEGNRKISQFVRKGGKFLGFCAGGYYGSARVEFEVGNPRLEVSGPRELQFFP
GTSKGCAYKGFVYESHKGSRAAFIDVNTSILTDSPAQVVNYYNGGGVFLNASKYAGVQVL
ATYSADIDVEDTERAAVVYKKFGKGDVILTGTHPEFTPSLLKESDGDEKYAKVIQTIRDG
DHGRRMFFKSCLGKLGLKVNENVDVTVPKITPILLSSHLNKVTVNNLLSSLKSKEDFHGN
SLEDDNDTFVFHDETENDHDYFLDSSTDNVEDANSVPKHIKLFSEGNLPDPKTTPYFHMG
AYFSHLERLYNGKVGEFGSILGYGEVVTSTNTLMDRNPKLLRNLPNGFALTATTQVAGRG
RGGNVWINPKGVMAASVLFKIPSGETHASSVVTLQYLCGLALIESILGYGSFEDGKGVGY
EDMPVRLKWPNDIYILKPEFYTKISNKDETSSTVEGDDAKWAKVSGALINSQFLNNTFHL
VWGGGVNVSNEAPTTSLNIVLAKLNNIRTQKGLPELPPYQHELLLAKLMHTMDGFYSVFK
HSGLKPFLPLYYKRWFHSNQLVKLQRDGRERDVKVTGITADYGLLIAEDTSTKDLLFLQP
DGNSFDIFKGLIYKK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgctagtatattctggacagggaacgaccaccgaaagcgttaagcactgcttg
gaatcgttaaggctccatttatctccatattatgcagtggtgactatctcagagcagtcg
attctcaacgatccatggatttataagacatccttgttggtgattcctggaggcgccgat
ttgccttattgcaacgtatttaatggtgagggcaacagaaagatttcacagtttgtccgc
aaaggaggcaagttcttgggcttttgcgctggtggctattacgggtcagcaagagttgag
tttgaagtgggcaatcctcgtctcgaagtttcaggtccacgagagttgcaatttttccca
ggaacttcaaaaggttgtgcttataagggatttgtgtatgagtctcacaagggatcccgt
gctgctttcatagacgtcaatacttctatcttgacagactctcctgctcaagtagtcaac
tactacaacggtggaggagtctttttgaatgcttcaaagtacgcgggagtgcaagtattg
gctacctatagtgctgatatagatgtggaagacacggaaagagcggctgtggtatacaag
aagtttggtaaaggtgacgtcatcttgactggaactcatcctgagttcacaccatccttg
ttaaaggaatcagatggcgatgaaaagtatgccaaagtcattcagactatccgagacggc
gaccatgggcgtagaatgttcttcaaatcgtgcttaggcaagctaggtttgaaggttaat
gagaatgtagacgtcactgtacccaaaattactcccatattattgtcatctcatttgaat
aaggtcacggtcaataacttgttgagttccttgaaatcaaaggaggatttccatggaaac
tctttggaagacgacaacgacacgtttgtgttccatgatgagaccgaaaacgaccacgac
tattttcttgacagttcaactgacaacgtggaggacgccaatctggtgccaaaacacatc
aagctcttcagcgagggtaacttgcctgatcccaagacaacaccctactttcacatgggt
gcatatttcagtcatttggaacggttgtacaatggaaaggtgggagaatttggttccatc
ttggggtatggagaagtggtcacttctaccaatacgttaatggacagaaaccccaaactt
ttgcggaatttgcccaatggcttcgctttaactgctactacacaagtagccggaagaggt
cgtggaggcaatgtttggatcaaccccaaaggagtgatggcagcttcggttttattcaaa
atcccatcgggtgagacacatgcttcttcagtagtcactttgcaatacttatgtggattg
gcattgatagaatctatattgggatacggaagcttcgaagatggaaagggtgttggatac
gaagacatgccagtcagattgaaatggccaaatgatatctatatcttgaagccagaattc
tacaccaagataagcaataaggacgaaacaagttcgactgtagaaggagacgatgccaag
tgggccaaagtgtctggggctttgatcaactcccaattcttaaataatacattccacttg
gtgtggggaggaggtgtcaacgtgtctaatgaagctccaactacttcattaaatatcgta
ttggcgaaattgaacaatataagaactcaaaaggggttacccgaacttccaccttatcag
cacgaactactcttagccaagttgatgcatactatggatgggttctactctgtctttaag
cactctggtttgaaaccgttcttgccattgtactacaagagatggttccattccaatcag
ttagttaagctccaacgcgatggccgcgaacgtgatgtaaaggttaccggtatcacagca
gattacggattattaatagctgaggatactctgactaaggatttgctatttctacaaccc
gatggaaactcgtttgatatcttcaaaggattaatttataaaaagtag

DBGET integrated database retrieval system