KEGG   Scheffersomyces stipitis: PICST_70394Help
Entry
PICST_70394       CDS       T01023                                 

Gene name
GPM1.1
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00010  Glycolysis / Gluconeogenesis
pic00260  Glycine, serine and threonine metabolism
pic00680  Methane metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01200  Carbon metabolism
pic01230  Biosynthesis of amino acids
Module
pic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pic_M00002  Glycolysis, core module involving three-carbon compounds
pic_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_70394 (GPM1.1)
  Energy metabolism
   00680 Methane metabolism
    PICST_70394 (GPM1.1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PICST_70394 (GPM1.1)
Enzymes [BR:pic01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PICST_70394 (GPM1.1)
Membrane trafficking [BR:pic04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PICST_70394 (GPM1.1)
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PICST_70394 (GPM1.1)
  Exosomal proteins of melanoma cells
   PICST_70394 (GPM1.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 4837638
NCBI-ProteinID: XP_001382319
JGI: 70394
UniProt: A3LN94
Position
2
AA seq 248 aa AA seqDB search
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGEKEAKRAGELLKEAGIVADILYTSKLSR
AIQTANIALESADQLYIPVKRSWRLNERHYGALQGKDKAQTLETYGKEQFQTWRRSFDVP
PPPIEDDSEFSQFGDVRYKEIDPAVLPKTESLALVIDRLLPYWQDEIAGDLLDGKTVLIA
AHGNSLRALVKHLDKISDEEIAGLNIPTGIPLVYELDEKLQPTKPAYYLDPEAAAAGAAA
VAAQGTKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagttagttttagtcagacacggtcaatccgaatggaacgaaaagaacttgttc
acaggttgggtggatgttcgtttatctgagactggtgaaaaggaagccaagagagccggt
gaattgttgaaggaagctggtattgttgctgacatcttgtacacctccaagttgtccaga
gccatccagactgccaacattgctcttgagtctgctgaccaattgtacattcctgtcaag
agatcgtggagattgaacgaaagacactacggtgccttgcaaggaaaggacaaggcccag
accttggaaacctacggtaaagaacaattccagacctggagaagatctttcgatgttcca
cctccaccaattgaagacgattctgaattctcgcaatttggtgatgtcagatacaaggaa
atcgacccagctgtcttgccaaagaccgaatccttggctttggtcattgacagattgttg
ccatactggcaagacgaaattgccggtgacttgttggatggcaagaccgtcttgattgct
gcccacggtaactccttgagagccttggtcaagcacttggacaagatctccgacgaagag
attgctggcttgaacattccaaccggtatcccattggtttacgaattggacgaaaagttg
caaccaaccaagccagcttactacttggacccagaagctgctgctgccggtgctgctgcc
gttgctgcccaaggtaccaagaagtaa

DBGET integrated database retrieval system