KEGG   Scheffersomyces stipitis: PICST_70563Help
Entry
PICST_70563       CDS       T01023                                 

Gene name
PFK1
Definition
(RefSeq) 6-phosphofructokinase, alpha subunit
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00010  Glycolysis / Gluconeogenesis
pic00030  Pentose phosphate pathway
pic00051  Fructose and mannose metabolism
pic00052  Galactose metabolism
pic00680  Methane metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01200  Carbon metabolism
pic01230  Biosynthesis of amino acids
pic03018  RNA degradation
Module
pic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_70563 (PFK1)
   00030 Pentose phosphate pathway
    PICST_70563 (PFK1)
   00051 Fructose and mannose metabolism
    PICST_70563 (PFK1)
   00052 Galactose metabolism
    PICST_70563 (PFK1)
  Energy metabolism
   00680 Methane metabolism
    PICST_70563 (PFK1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PICST_70563 (PFK1)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PICST_70563 (PFK1)
Protein phosphatases and associated proteins [BR:pic01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PICST_70563 (PFK1)
Messenger RNA biogenesis [BR:pic03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PICST_70563 (PFK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK UVR DAGK_cat
Motif
Other DBs
NCBI-GeneID: 4837256
NCBI-ProteinID: XP_001382396
JGI: 70563
UniProt: A3LNQ5
Position
2
AA seq 978 aa AA seqDB search
MPVPESIQGLSFVSIVTNDQTKFEKLAKFYTRFGFKLSKNFSKVSNNGAASASNNPRLHL
GVSNDSLREVWLESFPLQNLDGNGNVTPWQELAVYDGDNCEKLCDSTLIKIRLSNLNVIS
DVVKKFRFFSTDLKQIKAILTELKWTFVELEGEIDTKDPLGNVLIFSSTANPLSKESFGS
ADEYLTIKSQQLLRDLSKSSEVDSTYSESVSETIRKKKIAVMTSGGDAPGMNPAVRAVVR
AGIFLGCDMFAVYEGYSGLVKGGDLLKKMEWGDVRNYLSYGGTNIGTARCMEFKEREGRL
SGAYNMIVNGIDALIVCGGDGSLTGADLFRSEWPSLLDELIETARLTKEEVAPYRHLTIV
GLVGSIDNDMSCTDATIGAYSALERITEMVDYIDATAKSHSRAFVVEVMGRHCGWLGLMS
GLGTGADFIFIPERPPRAGKWHDDLKTVCKRHREKGRRKTVVIVAEGAIDDELNPISSEE
VRDVLVELGLDTRITTLGHVQRGGTAVAYDRMLATLQGVDAVKAVLESTPETPSPMIGVF
ENKIVRQPLVEAVRLTKSVATAIENKDFDRAMSLRDTSFADAYSHFLSTSVDDDGSSELP
KDKQLNIGVIHVGAASSGLNAATRAAALYSLSRGHKLFAIQNGFSGLIKDGIVKELKWLD
VEDWHNRGGSEIGTNRSLPSENYGKVAFYLQKYNLQGLIIIGGFEAFTALNELNEKDDSY
PIFAMPKVAIPATVSNNVPGTEYSLGSDTCLNQLVKYCDAVKQSASSSRRRVFVVEVQGG
HSGYVAAYTGLITGAMATYAPESKINLRTIQEDIDLLFNVFAHDRGEDNNGKMLIRNEQA
STVYSTELIADIIKENAKGRFETRTAIPGHVQQGFTPSSADRVNAVKFAVKSVQYIEEWN
GSCERDPAIVDYEKTASVVIGIQGAQVKFTSVKELYQNEANIKLRKGKTVHWKDMSDVSD
MLSGRLNLRAKKQSVKLL
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttccagagtcgatccagggcctcagcttcgttctgattgtcaccaacgatcaa
acgaaatttgagaagttggctaaattctacaccagattcggcttcaaattgctgaaaaat
ttctcgaaagtgtccaacaacggtgctgcttcggcctccaacaacccacgcttgcatttg
ggagtttctaacgactctttgagagaggtctggcttgaatcctttcctttgcagaaccta
gatggcaatggaaatgtgactccttggcaggaattggctgtatacgatggtgataactgc
gaaaaattgtgtgattctactttaatcaagattcggttgtcgaatttgaacgtaatcagt
gatgtcgttaaaaagtttcgctttttcagtaccgatttgaagcaaattaaggctatttta
actgaattgaagtggaccttcgtagaattagaaggcgaaattgacaccaaggacccccta
ggtaacgtgttgatcttctccagcaccgctaacccgttgtcgaaggagtcgttcggttct
gcggacgagtacttaacgataaagtctcagcagcttcttcgggatttgtccaagtcctca
gaagtcgattcgacatattctgagtcggtttcggagacaatcagaaagaaaaaaatcgcc
gtcatgacttctggaggtgatgctccaggtatgaaccctgctgtgagagctgttgtcaga
gccggaatctttttgggatgtgacatgtttgctgtctacgaaggctactcgggtttggtt
aaaggtggagacctcttgaagaagatggagtggggagatgtcagaaactacttgtcatac
ggtgggactaacattggtactgccagatgtatggagttcaaggaacgtgaaggcagattg
tctggtgcgtacaatatgattgtcaacggaattgatgctcttattgtgtgtggaggtgat
ggttcattgactggtgctgatttgttcagaagcgagtggccttctttgcttgacgaattg
atagaaactgctcgtttgaccaaagaagaggtcgccccatacagacacctcaccattgta
ggattggtgggctctatagataacgacatgtcatgtacagatgcaacaattggtgcctat
tcggcgttagagagaatcaccgagatggtggactacatcgacgctacggccaagtcacat
tcccgtgcttttgttgttgaagttatgggtagacattgtggctggcttggcttgatgtct
gggttgggtactggagctgacttcatcttcattcctgaaagacctcccagggctggcaag
tggcacgacgacttgaagacggtctgcaagcgccacagagaaaaaggaagaagaaagacg
gttgtcattgtggccgagggagccatcgatgacgagttgaatcccatttcttcggaagag
gtcagagacgtcttggtcgagttgggtttggacaccagaatcaccaccttaggccatgtg
caaagaggtggtactgctgtagcttacgacagaatgcttgctaccttacaaggtgtagat
gctgtcaaggctgttcttgagtctactcctgaaacaccctctccaatgattggtgttttt
gagaataagatcgtcagacaacctttggtggaagctgtgagattgaccaagtctgtggcc
acagcaattgaaaacaaggatttcgacagggctatgagcttgagggatacttcgtttgct
gacgcatactctcacttcttgtctacctctgtagatgatgatggtctgtctgaattacct
aaagacaagcagttgaacatcggtgtaatccatgtaggagctgcttcgtctggtcttaat
gccgctaccagagctgctgccttgtacagtttgtctcgtggtcacaagttgtttgcaatc
caaaacggtttctccggtttaattaaggacggaatagtcaaggaattgaagtggcttgat
gtcgaggactggcacaacagaggtggctcggaaattggaaccaacagatctttgccctcg
gaaaactacgggaaggttgctttctatttgcaaaagtacaatttgcaaggtttgattatc
attggaggtttcgaggcctttactgccttgaacgagttgaacgaaaaggacgacagttat
cctatatttgcaatgcccaaagtagctattccagctacggtttctaacaacgtgcctgga
acagagtattctttgggttcagatacctgtttgaaccagttggttaagtattgtgatgcc
gtcaagcagtcagcctcatcgtcgagaagaagagtattcgttgtagaagtgcaaggggga
cattctggttacgttgcagcctacactggtttaattacaggtgctatggccacatatgcc
cccgaatccaagataaacttaagaactatacaagaggatatagacttattgttcaacgtt
tttgcccatgacagaggtgaagacaacaacggtaagatgttgatcagaaacgagcaggct
agtaccgtatactcgaccgagttaatcgcagacatcatcaaagaaaatgctaagggcaga
ttcgaaacaagaacggcaatacccgggcatgttcagcaaggctttactccgtcttcggcc
gacagagttaatgctgtgaaatttgcagtaaaatccgttcaatatattgaagagtggaat
ggctcgtgtgaacgagacccggctattgtagattacgagaagactgcgtctgtcgtcatt
ggcatccaaggtgcccaggtcaagtttacatcggtcaaggaattataccagaacgaagcc
aatataaagttgagaaagggtaagaccgtccactggaaggacatgtctgatgtaagcgac
atgttgagtggtcgcctcaatttgcgagccaagaagcagtcggtaaagttgctttag

DBGET integrated database retrieval system