KEGG   Scheffersomyces stipitis: PICST_71285Help
Entry
PICST_71285       CDS       T01023                                 

Definition
(RefSeq) predicted protein
  KO
K04649  ubiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:2.3.2.23]
Organism
pic  Scheffersomyces stipitis
Pathway
pic04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pic00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PICST_71285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pic04121]
    PICST_71285
Enzymes [BR:pic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     PICST_71285
Ubiquitin system [BR:pic04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   PICST_71285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con UBA_3 Prok-E2_B RWD UBA UEV
Motif
Other DBs
NCBI-GeneID: 4837749
NCBI-ProteinID: XP_001383781
JGI: 71285
UniProt: A3LRK3
Position
3
AA seq 220 aa AA seqDB search
MSRVKRIAKELEECRQDTQSGVSLKLNNENDLTKLTGFFKGPPGTPYQGGVFSVDITIPN
EYPFKPPVMKFSTKIYHPNISSVTGAICLDILKDAWTPILTLKSTLISLQSLLQSPEPND
PQDAEVAKHYLTNKTGFDETAAYWTKIYASDRDEEGKSEFSDSALYGIDESIVGQFENMG
FPRDKTIEVLRRMGVKSFNGVSNKGDLENQILEELLKECQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtgttaagagaattgccaaagaattagaagaatgtcgtcaagacacgcagtct
ggtgtttcgttgaagttgaacaatgaaaacgacttgaccaagttgactggtttcttcaaa
gggccaccaggcactccgtaccaaggaggtgtttttctggttgacatcaccatccccaac
gagtatccattcaaaccaccagtgatgaaattcctgaccaagatctaccatcccaacatc
tcgtcagtgactggggccatctgtttggatatcttgaaggacgcgtggactcccatcttg
acgttgaaaagcaccttgatatcattgcagtcgttgttacaatcgccggaaccaaatgat
ccacaagatgctgaagttgctaagcattacttgactaacaagacaggctttgatgaaaca
gctgcgtactggaccaagatctatgctagtgacagagacgaagagggcaagtccgagttc
agcgactcggccctttacggaatagacgagtcaattgtaggccagttcgaaaacatgggc
ttcccccgtgacaagaccatcgaggtgttgagaagaatgggtgtcaagagcttcaacggt
gtcagcaacaagggcgacttggagaaccagatattggaagagttgcttaaagagtgtcaa
taa

DBGET integrated database retrieval system