KEGG   Scheffersomyces stipitis: PICST_74163Help
Entry
PICST_74163       CDS       T01023                                 

Gene name
NUO30
Definition
(RefSeq) NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial precursor
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00190  Oxidative phosphorylation
pic01100  Metabolic pathways
Module
pic_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PICST_74163 (NUO30)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     PICST_74163 (NUO30)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     PICST_74163 (NUO30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 4841066
NCBI-ProteinID: XP_001386464
JGI: 74163
UniProt: A3M007
Position
8
AA seq 281 aa AA seqDB search
MISRATILKRVAQNSRSISSCTVRSFSASVSIKKDHELVNLNTLPRRKPSELNVPLVNPT
EKYKEQIEELHKFGAYIMACMPKYIQQFSVWKDELTIYVAPSALRPTMVFLKNHTSAQFK
SCVDVTAADYPSRTNRFDVVYNLLSVRHNSRIRVKTYANETSAVPSLVPIYQGVNWFERE
TYDLFGIFFEGHPDLRRIMTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRVIYEPLELTQA
WRNFSVGSSVWEQVGEGKDFTPETFKLPTPEPEPTQDEQKK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaagagccaccatacttaaaagagtcgctcaaaactcgagatcgataagctct
tgtacagttagaagcttttcagcctccgtttccatcaagaaggaccatgagttagtcaat
ttaaacaccttgccaagaagaaaaccatctgaactcaatgtgccattggtgaaccccact
gaaaaatacaaggaacagattgaagaattgcacaagttcggtgcctacatcatggcttgt
atgcctaagtacatccaacagttttctgtgtggaaagacgaattgaccatctacgtggct
ccactggccttgaggcccaccatggtgttcttgaagaaccatacctctgctcagttcaag
tcgtgtgtagatgtcactgctgccgactacccatccagaacaaacagatttgatgttgtg
tacaacttgttgtctgtgcgtcacaactcgagaataagagtcaagacttacgctaatgaa
accagtgctgttccatcgcttgttcctatctaccaaggtgtcaactggtttgaaagagaa
acctacgatttgtttggtatcttcttcgagggacatccagatttgagaagaatcatgacc
gactatggttttgaaggtcaccctttgagaaaggactttccaactaccggttacacagaa
gtcagatacgacgaagaaaagaaaagagtcatctatgaacctttggaattgacccaagct
tggagaaacttctccgtaggttcttctgtttgggaacaggttggtgaaggtaaggacttt
actccagaaacattcaagttgcctaccccagaaccagaacctactcaagatgaacaaaag
aaatag

DBGET integrated database retrieval system