KEGG   Scheffersomyces stipitis: PICST_74520
Entry
PICST_74520       CDS       T01023                                 

Symbol
VAC8
Name
(RefSeq) vacuole memebrane protein required for vacuole inheritance
  KO
K08332  vacuolar protein 8
Organism
pic  Scheffersomyces stipitis
Brite
KEGG Orthology (KO) [BR:pic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pic04131]
    PICST_74520 (VAC8)
   03029 Mitochondrial biogenesis [BR:pic03029]
    PICST_74520 (VAC8)
Membrane trafficking [BR:pic04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Other Cvt associated proteins
    PICST_74520 (VAC8)
  Other autophagy associated proteins
   Micronucleophagy associated proteins
    PICST_74520 (VAC8)
Mitochondrial biogenesis [BR:pic03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    PICST_74520 (VAC8)
SSDB
Motif
Pfam: Arm HEAT_EZ HEAT_2 HEAT Adaptin_N KAP Arm_2 Cnd1 ELMO_ARM V-ATPase_H_C Vac14_Fab1_bd DUF5578 Lysozyme_like
Other DBs
NCBI-GeneID: 4850917
NCBI-ProteinID: XP_001387723
JGI: 74520
UniProt: A3GF68
Position
1:complement(429793..432407)
AA seq 561 aa
MGICCSCLKGRSGDGSQTQLLLAENEREAISALLQYLENRSDVDFFSNGPLRALSTLVYS
ENIDLQRSAALAFAEITEKDVREVNRDVLEPILILLQSTDSEVQRAACGALGNLAVNTEN
KILIVEMGGLEPLIRQMMSTNIEVQCNAVGCITNLATQDDNKSKIAKSGALIPLTKLAKS
KDIRVQRNATGALLNMTHSGENRQELVNAGAVPVLVSLLSNDDADVQYYCTTALSNIAVD
EANRKKLASTEPKLVGQLVNLMDSPSPRVQCQATLALRNLASDSGYQVEIVRAGGLPHLV
QLLTCNHQHLVLAAVACIRNISIHPLNEALIIEAGFLKPLVSLLDYTDSEEIQCHAVSTL
RNLAASSEKNRTALLAAGAVDKCKELVLKVPLSVQSEISACFAILALADDLKPKLYESHI
IDVLIPLTFSENGEVCGNSAAALANLCSRVSNDHKQYILNNWSQPDEGIYGFLIRFLQSG
SATFEHIALWTILQLLESNNLEINSLIKENESILSGIKNLSASQQQAQSQSQLNQQTSED
QFDDPKVELFNLTQQILQILG
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgggtatctgctgtagttgcttgaaaggccgtctgggcgacggtagtcaaacacagctc
cttttggccgaaaatgaaagagaagcaatctctgccttgttgcaatacttagaaaatcgt
ctggacgtagactttttctcaaacggccccttaagggctctcagcactttggtgtattcg
gaaaatatcgacttgcaaaggtctgcagctcttgcatttgccgaaatcaccgagaaggat
gtccgtgaagtcaacagagacgttttagagccgatactcattcttttgcaaagtaccgac
tcagaagtgcagagagcggcctgcggagccttaggcaacttggctgttaacaccgaaaac
aagattctaatcgtggaaatgggcggattagaacctttgatcagacagatgatgtcgacc
aacatagaagtacaatgtaatgctgtaggctgcatcactaacttggctacccaagacgac
aacaagtccaagatagcaaagagtggagctcttattccgttaaccaaattggcaaagtca
aaggatatcagggtgcagagaaatgccactggtgctcttttgaacatgacccattccggc
gaaaacagacaagagttagttaatgctggagctgtgcctgtattggtatcgttattatct
aacgatgatgccgatgtccaatactactgtactaccgccttatccaacatagctgtagat
gaagccaaccgtaagaaactcgccagtacagagcccaaactcgtaggtcaattggtcaac
ttaatggactctccatcccccagagtacaatgtcaagctacacttgccttgagaaacttg
gcttccgactctggataccaggttgaaatcgtcagagctggtggattacctcatttagtc
cagttgttgacgtgtaatcaccagcatttggtactcgctgctgtagcatgtattagaaac
atttctatacatcccttgaacgaggccttgatcatcgaagcgggtttcttaaaaccattg
gtaagtttgcttgactacacagacagtgaagaaatccagtgccatgctgtttcgacgttg
agaaacttagctgcatctagtgaaaagaacagaacagctttgttagctgctggagctgta
gacaaatgtaaggaattggtattgaaggtgccattatcagtgcagctggaaatttctgct
tgttttgccattttagccttggctgacgatttaaagccaaagttatacgaaagtcacatt
attgatgttcttattcctttgacattcagcgaaaacggtgaagtttgtggtaactcagca
gccgcgttagccaatttatgttctagagtatccaacgaccacaaacaatatatcttgaac
aactggtctcagccagatgaaggtatctatgggttcttgatcagattcttgcagagtgga
agtgccacctttgagcacattgcattgtggaccatcttacagctcttggaatccaacaac
ctcgagatcaactcgttgatcaaagaaaacgaatccatcctttcaggcataaagaatttg
agtgcatctcaacaacaggcacaatcacaatcacagttgaatcagcaaaccagtgaagat
cagttcgatgatccaaaagtggaactcttcaacttgacacaacaaatcttgcaaatctta
ggataa

DBGET integrated database retrieval system