KEGG   Scheffersomyces stipitis: PICST_78364Help
Entry
PICST_78364       CDS       T01023                                 

Gene name
CAR1
Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00220  Arginine biosynthesis
pic00330  Arginine and proline metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01230  Biosynthesis of amino acids
Module
pic_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    PICST_78364 (CAR1)
   00330 Arginine and proline metabolism
    PICST_78364 (CAR1)
Enzymes [BR:pic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PICST_78364 (CAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 4839320
NCBI-ProteinID: XP_001385197
JGI: 78364
UniProt: A3LVR6
Position
5
AA seq 317 aa AA seqDB search
MTEIQYKFHPNKKATIITAPFSGGQPKGGVELGPEYILNAGFEKQAQALGWETAVVHPLA
NTDYESKKTDDKDSYGIKNTSIVSQCCEKIHTAVKSALDSDSLPITVGGDHSIGMATVSA
ALEHNPDACVLWIDAHADINTPKTTDSGNLHGCPISFVMGIDRESFPPEFSWVPENLKPN
KIAYIGLRDVDEGEKAILKKYNIPAFSMYHVDKYGIGKVVDMALDAVNPDRKNPIHLSYD
VDAIDPSFVPATGTRVEGGLSLREGLFIAEDVAQTGLLASIDIVETNPLLAETEEHVLDT
VSAACAIGRCALGQTLL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatccaatacaagttccaccctaacaagaaggccaccatcatcacggctcca
ttttccgggggccaacccaagggaggagtcgagttaggcccagaatacatcttgaacgcc
ggatttgagaaacaagcccaagccctcggatgggagactgctgtggtccatcccttggca
aacaccgactacgaatcgaagaagaccgacgacaaggactcgtatggaatcaagaacacc
agcattgtgtcgcaatgctgcgaaaagattcacactgctgtgaaatccgctttggattcc
gacagcttgcctatcacagtcggaggagaccattccatcggtatggccactgtctcggct
gctcttgaacacaaccctgacgcatgtgtgctttggattgacgcccatgctgacatcaac
actccaaagacaactgattccggaaacttgcacggctgtccaatctcatttgtaatgggt
atcgacagagagtcgtttcctcccgaattcagctgggttcctgaaaacttgaagcctaac
aaaattgcttacattggattaagagacgtcgacgaaggagaaaaggctatcttgaagaaa
tacaacatcccagcattctccatgtaccacgtcgacaagtacggaattggaaaagtagta
gacatggctcttgatgccgtcaaccctgacagaaagaacccaattcacttgtcgtacgac
gtagatgccatcgacccttcgtttgttcctgccacaggaaccagagtcgaaggtgggttg
tcgttgagagaaggtttgttcattgctgaagatgtagcccaaaccggtttgttggcttct
atcgatatcgtggagactaacccgttattggctgagactgaagaacacgtcttggacaca
gtgagtgcagcttgtgccatcggtagatgtgccttgggtcaaactcttttgtag

DBGET integrated database retrieval system