KEGG   Scheffersomyces stipitis: PICST_79135Help
Entry
PICST_79135       CDS       T01023                                 

Gene name
ACS2
Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00010  Glycolysis / Gluconeogenesis
pic00620  Pyruvate metabolism
pic00640  Propanoate metabolism
pic00680  Methane metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_79135 (ACS2)
   00620 Pyruvate metabolism
    PICST_79135 (ACS2)
   00640 Propanoate metabolism
    PICST_79135 (ACS2)
  Energy metabolism
   00680 Methane metabolism
    PICST_79135 (ACS2)
Enzymes [BR:pic01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PICST_79135 (ACS2)
Lipid biosynthesis proteins [BR:pic01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PICST_79135 (ACS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 4840021
NCBI-ProteinID: XP_001385819
JGI: 79135
UniProt: A3LXD8
Position
6
AA seq 679 aa AA seqDB search
MTVTPQHQVVHEANGVTPRPTPKEFFDKQPRPGHITSIEQYQELYQKSIADPEGFFGPMA
KELLSWDRDFDKVKSGSLKDGDVAWFIGGQLNASYNCVDRWAYATPDKTAIIYEADEEKD
SYKLTYAELLREVSKVAGVLKSWGIKKGDTVAIYLPMTPQAVIAMLAVARLGAIHSVIFA
GFSSGSIRDRVNDASCKALITCDEGRRGGKTVNIKKLCDEALKSCPTVEKVLVFKRTGNE
NIELEEGRDFWWDEETAKFSGYLPPVPVNSEDPLFLLYTSGSTGTPKGVVHTTGGYLLGA
AMTTKYIFDVHPEDILFTAGDVGWITGHTYALYGPLALGIPTIVFEGTPAYPDFGRFWQI
VEKHKATHFYVAPTALRLLRKSGEQEIPKYDLSSLRTLGSVGEPISPDIWEWYNEHVGQG
RCHISDTYWQTESGSHFIAPIAGVTPNKPGSASLPFFGIETALIDPVSGHELEGNDIEGV
LAIKSTWPSMARSVWNNHTKYMDTYLNPYPGYYFTGDGAARDHDGYYWIRGRVDDVVNVS
GHRLSTAEIEAALIEHNGVSEAAVVGITDDLTGQAVVAYVALKNEYVDKIAGKETSDEAF
ALRKELIMTVRKEIGPFAAPKSVIIVADLPKTRSGKIMRRILRKISANEADQLGDITTLS
NPQSVVGIIDSFAAQFAKK
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgactgttaccccacagcaccaagtcgtccacgaggccaacggtgtcaccccaagaccc
actcctaaggagttttttgacaaacagccccgtcctggccatatcacctccatcgaacag
taccaggaattataccagaagtccatcgccgaccctgaaggattctttggtcctatggcc
aaggagttgttgtcgtgggacagagacttcgacaaggtcaagtccggttctttgaaggac
ggtgacgttgcctggttcattggcggccagttgaacgcttcctacaactgtgtagacaga
tgggcctatgcgactccagacaagactgccatcatctacgaagctgacgaagaaaaggac
tcgtacaagttgacctacgccgagttgttgagagaagtctccaaggtagctggtgtgttg
aagagctggggcatcaaaaagggtgatactgttgctatctacttgccaatgactcctcaa
gctgttattgctatgctcgctgtagccagattaggtgccatccactcggttatctttgca
ggtttctcttctggttccatcagagacagagtcaacgatgcttcttgtaaggctcttatt
acctgtgacgaaggtagaagaggtggtaagaccgttaacatcaagaaattgtgcgacgaa
gccttgaagagctgtcctactgtagaaaaggtgcttgttttcaagagaaccggaaacgaa
aatattgaattggaagagggtagagatttctggtgggatgaagaaaccgccaagttctcg
ggttacttgccacctgttccagtcaattctgaagacccattgttcttgttgtatacatct
ggttccactggtactcctaagggtgttgtccacaccactgggggctacctcttaggtgct
gccatgaccaccaagtacattttcgacgtccacccagaagacatcttgttcactgccggt
gatgtcggttggattactggtcacacctatgctttgtacggacctttggctctcggtatc
ccaacaatcgtttttgaaggtactccagcctacccagactttggtagattctggcaaatt
gtcgaaaagcacaaggctacccacttctacgtagctcctactgccctcagattgttgaga
aagagtggcgagcaagagattccaaagtacgacttgtcttctttgagaacattgggctct
gttggtgaacctatctcccctgatatctgggaatggtacaacgagcacgttggacaaggc
agatgccacatctccgacacctactggcaaactgagtctggttctcacttcattgctcca
attgccggtgtcactccaaacaaacctggttcagcctctttgccattctttggtatcgag
accgctcttattgatccagtttccggccacgaactcgaaggtaacgacatcgaaggtgtt
cttgccatcaagagcacctggccatctatggctagatctgtctggaacaaccacaccaag
tacatggacacatacttgaacccatacccaggctactactttaccggcgacggtgctgcc
agagatcacgacggctactactggattagaggtagagtcgatgatgtcgtcaatgtgtct
ggtcacagattgtctactgctgaaatagaagctgccctcatcgaacacaacggtgtttct
gaagctgctgtggttggtattaccgacgacttaactggtcaagccgtagttgcctacgtt
gctctcaagaacgaatacgtcgacaagatcgccggcaaggaaaccagcgacgaagccttt
gccttgagaaaggaattgatcatgaccgtcagaaaggaaatcggacctttcgcagctcca
aagagcgtcatcattgtcgccgacttgccaaagaccagatctggtaagatcatgagaaga
atcttgagaaagatctctgccaacgaagcagaccaattgggtgacatcaccactttgtcc
aaccctcagtctgtcgttggtataatcgactcctttgctgctcaatttgctaagaaataa

DBGET integrated database retrieval system