KEGG   Scheffersomyces stipitis: PICST_81177Help
Entry
PICST_81177       CDS       T01023                                 

Gene name
PDX1
Definition
(RefSeq) pyruvate dehydrogenase complex protein X
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00010  Glycolysis / Gluconeogenesis
pic00020  Citrate cycle (TCA cycle)
pic00620  Pyruvate metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
pic01130  Biosynthesis of antibiotics
pic01200  Carbon metabolism
Module
pic_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_81177 (PDX1)
   00020 Citrate cycle (TCA cycle)
    PICST_81177 (PDX1)
   00620 Pyruvate metabolism
    PICST_81177 (PDX1)
Enzymes [BR:pic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PICST_81177 (PDX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 4851935
NCBI-ProteinID: XP_001387188
JGI: 81177
UniProt: A3GI36
Position
1
AA seq 418 aa AA seqDB search
MLRAVYAARKTGGSKILVAARGLHHSAPTMAAQVFTMPAMSPTMSEGGIVSWKFKPGEAF
NSGDVLLEVETDKATIDVEAVDDGKMWEIIVNDGAKGVAVGEPIALLAEPEDDLSTLERP
VLETKATKPAETAEAPKAVKTEEPVASKTPAAPKTSGSTEIFAQANVSQKLSPAVELLLH
ENDISVEDALGSIPASGPKGRLLKGDVLAHLGSISKDSIIKVTEFIKSREHLDLSNIKAE
AAAPKPEAKAPAPEPVKPKNVLTVELTSALDGDISKEKFKYAFERSIEVAIRQTYGRKFP
QYATSPVGSSLTAADDLFDDLLTPSVTKSRFEVYGINYKFFGPSLAAPSKAQSIASDFDE
LLGLTSSSPAYVEEGSAKVNVEFKIKFDEKLSDSKDFVSVFEDSLLSQIPANKLKISN
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttgagagccgtttacgcagctagaaagaccggcggatcgaagatacttgtcgccgct
agaggcttgcatcattctgctcctacaatggcggcacaggtatttaccatgcctgccatg
tctcccacgatgagcgaaggaggaattgtcagctggaagttcaagcctggtgaagcattc
aattctggcgatgttctcttggaagttgaaaccgacaaggctaccattgatgtagaagct
gtagacgatggtaaaatgtgggagattattgtaaatgacggtgccaagggtgtagctgta
ggtgaacctattgctttgcttgctgaacctgaagatgacttgctgactttggaaagacca
gttttagaaaccaaggctacaaagcctgcagaaacagcagaagcaccaaaggcagtcaaa
actgaagaacctgtagcttccaaaactcctgctgctcctaaaacttctggctctactgag
atttttgcccaggcaaatgtatcacagaagttatcaccagcggtcgaattgttattgcac
gaaaacgacatttccgttgaagatgctttgggttctattccagcctcgggtccgaagggt
agattgttgaagggtgacgttttggcccatttgggttccatcagtaaagactctattatc
aaagttactgaatttatcaagtctagggaacacttggatttgtccaatattaaggccgaa
gctgctgctcctaagcctgaagcaaaagcccctgctccagaaccagttaagcctaagaat
gtcttgaccgtagaattgacttcagctttggatggagatatctccaaggaaaagtttaaa
tatgcatttgaaagatcaatcgaggtcgccattagacagacgtacggccgcaagttccca
cagtatgctacatcgcctgtgggctcttcgttgacagccgccgatgatctcttcgacgat
ttgctcacaccttctgtaacaaagtccagatttgaagtctacggcatcaactacaaattc
tttggtccaagcttagcagccccatcgaaagcacagagcattgccagcgattttgatgag
cttttgggcttgacgtcgtcatctccagcttatgtagaagaaggcagtgctaaggtcaat
gtcgaattcaagatcaagtttgacgaaaagttgagcgactcaaaggattttgtgtccgtg
ttcgaggactcacttctctcacaaatcccagccaataagttgaagatctccaactga

DBGET integrated database retrieval system