KEGG   Scheffersomyces stipitis: PICST_81660Help
Entry
PICST_81660       CDS       T01023                                 

Gene name
MSM1
Definition
(RefSeq) methionyl-tRNA synthetase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00450  Selenocompound metabolism
pic00970  Aminoacyl-tRNA biosynthesis
pic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PICST_81660 (MSM1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PICST_81660 (MSM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pic01007]
    PICST_81660 (MSM1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pic03016]
    PICST_81660 (MSM1)
Enzymes [BR:pic01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PICST_81660 (MSM1)
Amino acid related enzymes [BR:pic01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PICST_81660 (MSM1)
Transfer RNA biogenesis [BR:pic03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PICST_81660 (MSM1)
 Prokaryotic type
   Other AARSs
    PICST_81660 (MSM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 SF-assemblin
Motif
Other DBs
NCBI-GeneID: 4836955
NCBI-ProteinID: XP_001382407
JGI: 81660
UniProt: A3LNS6
Position
2
AA seq 584 aa AA seqDB search
MKTFPRLSRAKSALRGIRFASSKPFYVSTPIFYVNASPHLGHLYSMLLADTRTRWEKLDP
KKSAYFLTGTDEHGLKIQTAAEKSGLSPKQLVDSVSQNFKVLAEKFNVDYDRFIRTTDTD
HTEVVQFFWNMMMEKGFIHEGSHSGWYSVSDETFYPETQIEEVVDENGTKKMVSSESRSE
VVFQEEENYFFKLSDFQDQLISFLEKNPKFILPEHRYTQILNILKEAPLPDLSISRPSSR
LKWSIEVPNDPEQKIYVWFDALLNYLTATGYPQTFPVENNRFVTSPENPWPATHIVGKDI
IKFHTIYWPIFLLAAGIELPKQVIVHAHWLSDGFKMSKSLGNVVDPFDILEYYGEDAVRF
FLMENSNIQDDCKYREELLHQTREAIIGKYANLMSRCGNSKFDIRQSVEDWRNGRFSDVD
TLINEQALNKDQTQSIIEARDNLVASLNGLYTNMDSKLADFDHSRAIQNWWTAVYYGNQL
FQLSEPWLYTKLLKDTAVSDADKESYRILQNYFVFLAAETVRITSILITPIVPRLSEKIL
DRLSVASGARNSEYCEVGADLQFGVGANSKSHRLPIEKVALRGD
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattccccagactctcaagggccaaaagtgcccttcgaggtattcggttcgct
tcttcgaaaccattttacgtctctacgcccattttctacgtgaatgccagtccccatttg
ggccatctctactccatgcttttggcagataccagaacaagatgggaaaaactcgatcca
aagaagctggcgtactttttgacgggcacagacgaacacggtttgaagatacagacagcg
gcggaaaaatccggtctttctcccaagcaattggttgactcagtttctcaaaacttcaaa
gtattggccgaaaagttcaatgtagactacgacagattcataagaacaactgatactgac
catacagaagtagttcagtttttctggaacatgatgatggagaaaggattcatccacgaa
ggctctcacagtggctggtactctgtcagcgacgagaccttctatccagaaacccagata
gaagaagttgtagacgagaacggaaccaaaaagatggttagttccgagtcgagaagcgaa
gttgtcttccaagaggaagaaaactactttttcaaactatcggacttccaggatcaactt
atatctttccttgaaaagaatcccaagttcatcttgcctgaacacagatatactcagatc
ttgaacattctcaaggaagcacctttacccgatttgtccatttccagaccttcgtcacga
cttaaatggagtattgaagtgcctaacgatcctgagcagaagatctacgtctggtttgat
gctcttctcaattatttgacggctacgggttatccccagactttccctgtcgagaacaac
agattcgtaactctgccagaaaacccctggccagctacccatatcgtaggcaaggatatc
atcaagttccatacaatctattggcccatttttctcctagctgcgggaatagaattgcca
aaacaggtaatcgtacacgcgcactggttgagcgatgggttcaagatgagtaaaagcttg
ggcaatgttgtagacccatttgatatcttggagtactatggggaggacgctgtaagattc
ttcttaatggaaaactctaacatccaggacgattgtaagtaccgtgaagagcttcttcat
cagactagagaagccattattggcaaatatgccaatttgatgtctcgttgtggaaacagc
aagttcgatattagacaaagtgtggaagattggagaaacggcagatttagcgacgtagat
actcttatcaatgaacaggcattgaataaggaccaaacacagagtataatagaagccaga
gacaacttggttgccagcctcaatggtttatacacaaatatggattcgaaacttgctgat
tttgatcacctgcgggccattcagaactggtggactgctgtgtactatggcaatcagctc
ttccagttatccgagccttggctctatacaaagctcttgaaggatactgcggtgagtgac
gccgataaggaaagctaccgaatcctacaaaattactttgtatttttggcagctgaaact
gtgagaataacctctattttaatcacgcctattgtcccacgtttgtcggagaagatcttg
gacagattgagtgtagcttctggagccagaaactctgaatattgtgaagtgggtgccgat
ttgcagtttggcgtgggtgcaaattcaaaactgcacaggttgccaatagagaaggtggcc
ttgagaggtgattag

DBGET integrated database retrieval system