KEGG   Scheffersomyces stipitis: PICST_86369Help
Entry
PICST_86369       CDS       T01023                                 

Gene name
SAP11
Definition
(RefSeq) member of the AAA ATPase family of proteins
  KO
K22766  fidgetin-like protein 1 [EC:3.6.4.-]
Organism
pic  Scheffersomyces stipitis
Brite
Enzymes [BR:pic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     PICST_86369 (SAP11)
Chromosome and associated proteins [BR:pic03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    PICST_86369 (SAP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Vps4_C AAA_22 RuvB_N TIP49 AAA_16 AAA_2 AAA_5 Mg_chelatase IstB_IS21 AAA_14 AAA_18 AAA_33 DUF815 AAA_25 NACHT
Motif
Other DBs
NCBI-GeneID: 4851556
NCBI-ProteinID: XP_001388033
JGI: 86369
UniProt: A3GH07
Position
1
AA seq 810 aa AA seqDB search
MFRKKPPQLSLLEELRQTYDDCCNFSIKNLALEENNHVEDALKGWKGLHTSLLYKIDLFD
RSAHKLSNDEIQILTELKAIRDQNVKHLIRVQLRMDEVNRKKSRDATNAVHAASKQASSS
SSSSLSVPSLRNPASRSLSSNSVNQRSMLKSLRPGMVSGSSSQGSSSSYNVPKVKTAQAS
QAANVSWQGPQNRHKPSQKSAKELTETENELFDDFDDDGFEFTDNWERINDNNLNNVNNN
TNNNNNHNGSRSSSGLSELSSGRGSSSSNVNLIDLDDDNCNYDDLVRSMDDITLKPHASP
TRQHQSLSVPKVTLTNHSSGSINKTSATNGTTTNRRVDHISKSTSDIRTNHAPQTKQPYI
YNKPKPIDVSKIMKKQSQNRLNPTKSPTKQPTTVKSQPSKTAAAQRTTRTSNNSHTAKPK
TNPSSNISYNYVKTSKTVNPAVKKTVKPATLQPNKIMTNQKNKSSDAINSPTMDDLLSGY
DNDEVDVNLLTNEEEQEALINSVRGVDPDAAKHILNDIVIHGDEVYWDDLVGLESAKYSL
KEAVVYPFLRPDLFKGLREPTRGMLLFGPPGTGKTMLARAVATESKSTFFSISASSLTSK
YLGESEKLVRALFLMAKKLAPSIVFVDEIDSLLSSRTEGEVESTRRIKNEFLVQWSELSS
AAAGRESDNDDVSRVLILGATNLPWSIDEAARRRFARRQYIPLPEADSRSAQIRKLLQYQ
KNTLSDEDYEVLKDLTDGFSGSDITALAKDSAMGPLRALGEKLLSTPTEQIRPINLEDFK
NSLKYIRPSVSSEGLQEYEKWAEKFGSSGA
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgttccgaaaaaaaccccctcagctctcgctcctcgaggaactcagacagacctatgac
gactgctgcaacttcctgatcaagaacctcgccctagaggaaaacaaccacgtagaggat
gccctcaaaggctggaagggcttgcacacgtcccttctctacaaaatcgacttgtttgac
aggctggctcacaaactcctgaacgatgaaatccagatcctcacagagttgaaagccatc
agagaccagaacgtcaagcatttgatccgcgttcagttacgaatggatgaagtaaatcgc
aagaagagcagagatgccaccaatgccgtacatgctgcctctaaacaggcttcttcttcg
tcgtcgtcctcgctatctgttccttcactcagaaacccagcctccagatcgctttcaagt
aactcagtgaaccaacgctcgatgttgaagtctctaagaccaggaatggtgctgggactg
agttcacagggatctagtagctcgtataatgttcccaaggtgaaaactgctcaggcttcg
caggctgcaaatgtctcctggcagggtccccaaaatcgccataaaccttcccagaagtca
gcaaaagaacttaccgaaactgaaaatgagctctttgatgatttcgacgatgatggattc
gaattcaccgacaattgggaacgcatcaacgacaacaatcttaacaatgtcaacaacaat
accaacaataacaacaaccataatggctctcgctcatcctcaggcttgtcagaactatct
tcaggaagaggatcttcatcatccaatgttaatctcatagatctcgatgacgataactgc
aactatgatgacctagtgcgttccatggatgacatcactttgaaaccacatgcatcacca
acaaggcagcatcaactgttactggtaccaaaggttactcttaccaaccatagttctggc
agtatcaacaagacctcggctaccaatggaacaacaactaaccgtcgagtagatcacatt
tccaaaagcacatccgacattaggacaaaccatgcgccacagacaaagcagccgtatatc
tataacaagccaaaacctatagacgtcagcaagatcatgaagaaacaatcccagaatcgt
ttaaatccgacaaagagccctacaaagcaacctaccactgtcaaaagtcaaccttccaaa
acagctgcagctcaaagaactacacgcacatccaataatagccacactgcaaagccgaag
acgaatccaagcagtaacatatcttacaactacgtaaaaacttctaagactgtgaaccct
gctgttaaaaagacagtaaagccagctacacttcagccaaataaaattatgacaaatcag
aagaacaagagtagcgatgctatcaatagtccaaccatggacgatttattgagtggctat
gataatgacgaagtagatgttaatttattaacaaatgaagaggaacaagaggctctcatc
aactcagttagaggagtagaccctgatgcggccaaacacattttaaacgatattgttatc
catggcgacgaggtttattgggacgacttggtcggattagaaagtgctaaatactcgttg
aaagaggccgtagtatatccatttttgcgccctgatttatttaaggggttgagagagccc
actagaggcatgttgttgtttggtccgccaggaaccggtaaaacaatgttggcgagagct
gttgctacggaatcgaagtcaacatttttctctattagtgcatcatccttgacatctaag
tatttgggagagtccgagaagttggtgagggctttgtttttgatggcaaagaagctagct
ccatctatagtctttgtggatgaaatagattctttgttgagttccagaacagagggagaa
gtagaaagtacaagaagaattaaaaatgaatttttggtacagtggtccgaactttccagt
gcagcagccggaagagaatctgacaacgatgatgtttctagagttttgattctaggagcc
acaaatctaccttggtctatcgatgaggcagccagaagaagattcgcaagaaggcaatac
attcctttaccagaggcggactctagactggcacagattcgaaaattattacaataccag
aaaaatactctatcggacgaagattacgaggtcctcaaggacttgaccgatggattcagt
ggctcagacataactgctcttgcaaaggattcagctatgggaccgttgagagctcttgga
gaaaaacttctactgacacctacagagcaaattcgaccaattaaccttgaagactttaag
aacagtttgaagtacatcaggccaagtgtttcatcagaagggttgcaggagtatgaaaaa
tgggccgaaaaatttggatcttcaggtgcatag

DBGET integrated database retrieval system