KEGG   Scheffersomyces stipitis: PICST_89701Help
Entry
PICST_89701       CDS       T01023                                 

Gene name
SOR1
Definition
(RefSeq) polyol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PICST_89701 (SOR1)
Enzymes [BR:pic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PICST_89701 (SOR1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PICST_89701 (SOR1)
    1.1.1.-  
     PICST_89701 (SOR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 4839191
NCBI-ProteinID: XP_001385027
JGI: 89701
UniProt: A3LUQ0
Position
5
AA seq 385 aa AA seqDB search
MKAIVYHDREDVRYHSDFPEPQIVRPDDVKIKVHYCGICGSDLKEYLDGPIFFSKKGTNN
EVSNLPYPQCMGHEISGEVYEVGSEVDNLQIGDKVVVEVTGTCFDRYRFPESPNFNKPKC
GSCLEGHYNACAYLGLTGLGFTNGGCSEYLVTAASKAIKFQEDIIPMDVAAVIQPIAVSW
HAVRVSHFQEGQSALILGGGPIGLTTIFALKGNKAGKIVVSEPALARRQLAEKLGVTVFD
PTGKSVDECVEELRKLSPNGYGFNHSYDCSGVPATFQTSLRALNIRGTATNVAVWAHKSV
PYFPMEATWAEKIITGSICFVKDDFIDVVNALHEGTIPVDEVKLLITSKIHLEDGVEKGF
LELIHHKEKHIKILFSPKEEYRVKK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccatagtttaccatgacagggaagatgtccgctatcacctggacttccctgag
ccgcagattgtcaggcctgacgatgtcaagatcaaggtccattactgtgggatctgtggt
tctgacttgaaggagtatctcgatggaccgatttttttctccaagaagggtaccaacaac
gaagtttccaacttgccatatccgcaatgcatgggtcacgagatcagtggtgaagtttac
gaggtcggatctgaagttgacaaccttcagattggagacaaagtggtggtggaagtcaca
ggtacctgttttgacagataccggttccccgaatcgcccaacttcaacaaacccaagtgt
ggaagttgtctcgaaggtcactataatgcctgtgcatatcttgggttgactggcttaggt
tttaccaacggagggtgttctgaatatttggttacagctgctagcaaagccatcaagttt
caagaagatatcattccgatggatgtggctgctgtaatccagccaattgctgtcagttgg
cacgcggttcgcgtgtctcacttccaagaaggtcaaagtgctttgatcttgggaggtggc
cccattgggttgactaccatttttgcattgaagggaaacaaagctggcaagatagtcgtt
tctgagcctgctttggccagacgacaattggcagaaaagttgggcgtcacagtctttgat
cctaccggcaaatctgttgatgaatgtgtagaggagttgaggaagttgtcacccaacggc
tatggcttcaatcattcatatgattgttccggtgtgccagctactttccaaaccagtctc
agggcattgaatattagaggaacggctactaatgttgccgtgtgggctcacaaatccgtt
ccatactttcctatggaagccacctgggccgaaaagatcatcaccggatcaatttgcttt
gtcaaggacgattttatagatgtcgtcaatgctcttcacgaaggcactattccagttgac
gaagtcaagttattgatcacttccaagattcatcttgaggatggagtagagaagggcttt
ttagaattgattcaccacaaggaaaagcatataaagatcttgttttctcctaaggaagaa
tatagagtaaagaagtaa

DBGET integrated database retrieval system