KEGG   Scheffersomyces stipitis: PICST_90135Help
Entry
PICST_90135       CDS       T01023                                 

Gene name
CDC28
Definition
(RefSeq) cell division control protein
  KO
K04563  cyclin-dependent kinase [EC:2.7.11.22]
Organism
pic  Scheffersomyces stipitis
Pathway
pic04011  MAPK signaling pathway - yeast
pic04111  Cell cycle - yeast
pic04113  Meiosis - yeast
Module
pic_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:pic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    PICST_90135 (CDC28)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    PICST_90135 (CDC28)
   04113 Meiosis - yeast
    PICST_90135 (CDC28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pic03019]
    PICST_90135 (CDC28)
Enzymes [BR:pic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     PICST_90135 (CDC28)
Messenger RNA biogenesis [BR:pic03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     PICST_90135 (CDC28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7 Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 4839946
NCBI-ProteinID: XP_001385919
JGI: 90135
UniProt: A3LXZ6
Position
6
AA seq 310 aa AA seqDB search
MVELSDFQRQEKVGEGTYGVVYKALDTKHNNRVVALKKIRLESEDEGVPSTAIREISLLK
EMRDENIVRLYDIIHSDSHKLYLVFEFLDLDLKKYMESIPQGAGLGANMVKRFMNQLVKG
IKHCHSHRVLHRDLKPQNLLINKEGNLKLADFGLARAFGVPLRAYTHEVVTLWYRAPEIL
LGGKQYSTGVDMWSVGCIFAEMCNRKPLFPGDSEIDEIFRIFRILGTPTEEIWPDVSYLP
DFKPTFPKWSKKNLAEFVPTLDADGVDLLEQMLVYDPSGRISAKRALVHPYFQEEDGDNY
DSFPRSVNMG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggttgagttatcagacttccagcgccaggaaaaggtcggtgaaggtacctacggggtg
gtatacaaagctctcgacaccaaacacaacaaccgtgttgtagcattaaagaagatcaga
ctagaatccgaagacgaaggggttccatctacagctataagagaaatctcacttctaaag
gaaatgagagacgaaaacatcgtcagattgtacgatataatacactcggactcccacaag
ttgtatttggtatttgagttcttggatttggacttgaagaagtacatggagtccattcca
caaggtgctgggttgggtgccaacatggttaaacggttcatgaaccagttggtgaaagga
atcaaacattgccacagtcaccgtgttttgcacagagacttgaagcctcagaacttgttg
attaataaggaaggtaacttgaaacttgctgatttcgggcttgcccgtgcctttggtgta
cctttgagagcgtacactcacgaagtcgtcaccttatggtatagagctccagagatctta
cttggtggtaagcagtattcaaccggtgtagatatgtggtctgtaggctgtatcttcgca
gaaatgtgtaacagaaagcccctttttcctggtgattctgagatcgacgagatcttcaga
atcttcagaattttgggaacaccaaccgaagaaatctggcctgatgtgtcatacttgcca
gacttcaagccaacgttccctaagtggtccaagaagaacttggccgaatttgttcccact
ttagatgccgacggtgttgatttgctcgagcagatgttggtgtacgaccctagcgggaga
atcagtgctaagcgtgctttggtccatccatacttccaagaagaagatggtgacaactac
gacagcttccctagatctgtcaacatgggttaa

DBGET integrated database retrieval system