KEGG   Scheffersomyces stipitis: PICST_90444
Entry
PICST_90444       CDS       T01023                                 

Gene name
GDI1
Definition
(RefSeq) Secretory pathway GDP dissociation inhibitor
  KO
K17255  Rab GDP dissociation inhibitor
Organism
pic  Scheffersomyces stipitis
Brite
KEGG Orthology (KO) [BR:pic00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pic04147]
    PICST_90444 (GDI1)
Exosome [BR:pic04147]
 Exosomal proteins
  Proteins found in most exosomes
   PICST_90444 (GDI1)
SSDB
Motif
Pfam: GDI
Other DBs
NCBI-GeneID: 4839773
NCBI-ProteinID: XP_001385697
JGI: 90444
UniProt: A3LWP1
Position
6
AA seq 454 aa
MDENYDVIVLGTGLTECILSGILSVEGKKVLHIDRQDFYGGESASLNLSQLYTKFRPSAQ
RPELKGRDRDWCVDLIPKFLMANGELTNILVHTDVTRYIDFKQIAGSYVYRNGRIAKVPA
NEVEALRSNLMGLFEKRRMKRFLEFIQNYDEDTPSTHQGFNLDTNTMNEIYTHFGLENGT
KDFIGHAMALWHTDDYLNDVARPTYERIILYVQSVAKHGKSPYLYPLYGLGELPQGFARL
SAIYGGTFMLDTPIDEVLYDETDGVKKFAGVVTKEGTAKAPIVIADPTYFPEKVKKTGAR
VIRAMCILEHPVPNTGDTDSVQIIIPQNQVGRKHDIYIAVVSDVHCVVPKGYYLAIVSTI
IETDAPHIELEPAFKLLGPRIDTLMGITEIYEPINDGTADGIYISKSYDSSSHFESTTDD
VKDLYFRITGKPLVLKKRSTTEEESQDEATIGGL
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggacgaaaactacgacgtcatcgtgttgggcacaggtttgaccgaatgtattctctcc
gggatcttgtcggtagaaggcaagaaggtgttacacatcgaccgccaggacttctacggt
ggagaatcggcatcgttgaacttgtcccagttgtataccaagtttagaccttcggctcag
agaccggaattgaagggcagagaccgggactggtgtgtagacttgattcctaagttcttg
atggccaacggcgagttgactaacatcttggttcacacggatgtgactcgttatatcgac
ttcaagcagattgctggctcgtatgtgtaccggaatggccggattgccaaagttcctgcc
aatgaggtcgaggctcttagatctaacttgatgggcctctttgaaaagagaagaatgaag
cgtttcttggaattcattcagaattatgacgaagacacgccatcgacccaccagggtttc
aacttagataccaacaccatgaacgagatttatacccatttcggactcgagaatggaacc
aaggacttcattggtcatgccatggccctctggcacacggacgactacttgaacgatgtg
gcacgtccaacttacgaacgtatcatcttgtacgttcaatcagtagccaaacacggtaag
tccccttatctctatccattgtacggtttgggtgagttgcctcaaggatttgccagatta
tctgctatctatggaggaacctttatgttggatactccaattgacgaagtgttgtacgac
gagactgacggagtcaaaaagtttgctggtgttgtcactaaagaaggcacagcaaaggct
cctatcgttattgctgatcctacgtactttcctgaaaaggtgaaaaagactggtgccaga
gtcatcagagctatgtgtattttggagcatccagttcctaacacaggtgacactgactca
gtccagatcatcattccacagaaccaagttggtcgcaaacatgatatctacattgctgtt
gtctccgatgtccactgtgttgtaccaaagggctattacttggctattgtttcgactatt
atcgagacagacgctcctcacattgagttggaaccagctttcaaattattgggtcctaga
atcgataccttgatgggcatcaccgagatctacgagcccatcaacgacggcaccgctgac
ggaatctacatctccaaaagctacgactcatcctcacactttgagtcaaccacggacgac
gtcaaggacttgtacttccgtatcactggcaagcccttggtgttgaagaagagatcgact
actgaagaagaactgcaggacgaggctaccatcggaggtctttag

DBGET integrated database retrieval system