KEGG   Scheffersomyces stipitis: PICST_91253
Entry
PICST_91253       CDS       T01023                                 

Symbol
RGT2
Name
(RefSeq) glucose transporter/sensor
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
pic  Scheffersomyces stipitis
Pathway
pic04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pic00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    PICST_91253 (RGT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pic02000]
    PICST_91253 (RGT2)
Transporters [BR:pic02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    PICST_91253 (RGT2)
SSDB
Motif
Pfam: Sugar_tr MFS_1 CarS-like
Other DBs
NCBI-GeneID: 4840859
NCBI-ProteinID: XP_001386588
JGI: 91253
UniProt: A3M0N3
Position
8
AA seq 528 aa
MGLEDSALLQKYINFGEKKAGSTTMGICVGLFAAFGGILFGYDTGTISGIMAMDYVTARF
PSNHQSFSSSESSLIVSILSVGTFFGSLSASFISDRLGRRLTLMISTLIIFNVGIILQTA
STSIPLLCVGRVLAGLGVGLISAVIPLYQAETVPKWIRGAVVSCYQWAITLGLLLAAVVN
QGTHNRNDSGSYRIPIAIQFLWALILGGGMCLLPETPRFWVSKGDNDRAKDSLRRLRKLP
LDHPDLIEEYEEIKANYEYEAQYGSGSWSQVFANKNHQRKRLAMGVGIQALQQLTGINFI
FYYGTNFFKGSGIKNEFLIQMATNIVNFGSTVPGILLVEIIGRRKLLLGGSAVMSISQLI
VAIVGVAAGEGSTSANKCLVAFVCIFIAAFAATWGPLCWAVIAECYPLTVRQKSISLCTA
SNWLWNWGIAYATPYMVNSGPGNANLGSKVFFIWGGCNIIGGLFVWYLVYETKGLTLEQI
DEMYEKVPKAWQSTRFIPSEHAFTQPSAAASVSSGKAEGVSEVEEASV
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgggtttagaagacagtgctctcttgcaaaagtacatcaacttcggtgaaaagaaggct
ggttccaccaccatgggtatctgtgttggtttgttcgcagccttcggtggtatccttttc
ggttatgacactggtaccatctccggtatcatggccatggactacgtcactgccagattc
ccatccaaccaccaatctttcagttcttctgaatcttcccttattgtttccattttgtct
gttggtaccttctttggttctctttctgcatctttcatctccgacagattgggtcgtaga
ttgactttaatgatctccaccttgatcatcttcaatgtcggtattatcttgcaaactgcc
tctactagcattccacttttgtgtgttggtagagttcttgctggtcttggtgttggtctc
atttccgctgttattccattgtaccaagctgaaacagttccaaagtggatcagaggtgct
gttgtctcctgttaccaatgggccattacccttggtttgttgttggctgctgttgttaac
caaggtacccacaacagaaatgactctggttcctacagaatcccaattgctatccaattc
ttgtgggctttgattttgggaggtggtatgtgtttgttgccagaaaccccaagattctgg
gtttctaaaggtgacaacgacagagccaaggactccttgagaagattgagaaagttgccc
ctcgaccatcccgacttgattgaagaatacgaagaaatcaaggctaactacgaatacgaa
gctcaatacggttcaggttcttggagtcaagtttttgctaacaagaaccaccaaagaaag
agattggccatgggtgttggtatccaagccttgcaacaattgaccggtattaactttatc
ttctactatggtactaacttcttcaagggttctggtatcaaaaacgaattccttatccaa
atggccactaacattgtcaacttcggttctactgtcccaggtattcttttggttgaaatt
attggtagaagaaagttgttgttgggtggttctgcagttatgtccatttctcaattgatt
gttgctattgtcggtgttgccgctggtgaaggttcaacttctgccaacaagtgtttggtt
gccttcgtttgtatcttcattgctgctttcgcagccacttggggtcctctttgttgggct
gtcattgccgaatgttacccacttacagttagacaaaagtccatctccttgtgtacagct
tccaactggttgtggaactggggtattgcctacgctactccttacatggtcaactccggt
ccaggtaacgccaacttgggttccaaggttttcttcatctggggtggttgtaatatcatt
ggtggtcttttcgtgtggtaccttgtctacgaaactaagggcttgaccttagaacaaatc
gatgaaatgtacgaaaaggttccaaaggcttggcaatctaccagattcattccatccgaa
catgcattcactcaaccatccgcagctgcctctgtctcttctggtaaggctgaaggtgtt
tctgaagttgaagaagcttctgtatag

DBGET integrated database retrieval system